(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE3

ACIC5_1.PE3          Location/Qualifiers
FT   CDS_pept        complement(2178..2921)
FT                   /locus_tag="ACP_0003"
FT                   /gene_family="HOG000262113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine-rich domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="GI:225871702"
FT                   /db_xref="GeneID:7701219"
FT                   /translation="MRVSLFITCYNDLLFPETGRSLVRLLERLGHTVEFPREQTCCGQM
FT                   HYNTGYQREAMPLMQRFVEIFQDAEAVCIPSSSCVAMIRDHYPKMAASTGDARLVGAVN
FT                   ALLPRVFEFSELLVHKLGVEDVGAYYPHRVTYHASCHSLRSLQLGDLPLRLLRKVRSID
FT                   LVELPNADRCCGFGGTFAVKNGDVSAEMLAEKMRDVENTGAEVCAAVDNSCLMHIYGGL
FT                   HQRKVGIRTVHLAEILASTEEETVR"
FT                   /protein_id="YP_002753156.1"
     ttgcgcgtct cactctttat tacctgctac aacgacttgc tctttccgga gacaggcagg        60
     agtctggtcc ggctgttgga gaggttgggg catacggtgg agtttccccg cgagcagacc       120
     tgctgcggcc aaatgcatta caacaccggc tatcagcgcg aggccatgcc gctgatgcag       180
     cgatttgttg agatctttca ggatgcggag gcggtgtgca ttccctcttc ttcctgcgtg       240
     gcaatgattc gggatcacta ccccaagatg gcggcttcga caggagacgc gagacttgta       300
     ggcgcggtga atgcgctgct gccacgcgtg ttcgagttca gcgagctgct cgtccacaag       360
     ctgggagtgg aagacgtcgg cgcttactat ccgcatcgtg tgacctacca tgcgagctgc       420
     cattctctgc gcagtctgca actcggcgat ctgccgctgc gtctgctgcg caaggtgcgc       480
     agcatcgatc tggtggagct gcccaatgcc gaccgttgct gcggatttgg cggcacgttc       540
     gcggtgaaga atggcgatgt ttccgcagag atgctggccg agaagatgcg cgacgtggag       600
     aacacgggcg cggaggtgtg cgcggcggtg gacaactcct gcctgatgca catttatggc       660
     gggctacatc agcggaaggt ggggattcgc accgtacatc tcgcggagat tcttgcttcc       720
     acagaagagg agaccgtgcg atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page