(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE4

ACIC5_1.PE4          Location/Qualifiers
FT   CDS_pept        complement(3177..3653)
FT                   /locus_tag="ACP_0004"
FT                   /gene_family="HOG000100513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871703"
FT                   /db_xref="GeneID:7700831"
FT                   /translation="MYIQFQQYKLRSTKWEDIVSRIQPMHEKGLAMVAQDHLNPQNREL
FT                   RLEPDDIWQLLGGREGLKRMRKNADLLVNLAAYVQRWNFEEAVIIAERIRQDSMIVKRA
FT                   VFMIQLHMLLKKASPRVPFHMQQAAASYYLMTQRLLALYETCQYVRYPALAAAL"
FT                   /protein_id="YP_002753157.1"
     atgtacatcc agttccagca gtacaagcta cgctcgacga agtgggaaga cattgtctcc        60
     cgcattcagc ccatgcatga aaaaggcctc gccatggtcg cgcaagacca tctgaacccc       120
     cagaaccgcg agcttcggct agagccagac gatatctggc aattgctggg agggcgtgaa       180
     ggtctgaaga gaatgcgcaa gaatgcagac ctgctcgtga acctggcggc ctatgtgcag       240
     cgctggaatt ttgaagaggc ggtcatcatc gcggagcgca ttcgtcagga ttccatgatc       300
     gtgaagcggg cggtcttcat gattcagttg cacatgctgc tgaagaaggc ctcaccgcga       360
     gttcccttcc acatgcagca ggcggcagct tcttattatt tgatgacgca gcgactgctg       420
     gccctctatg aaacctgcca gtatgtgcgc tacccggctc tggccgcggc cctgtaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page