(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE5

ACIC5_1.PE5          Location/Qualifiers
FT   CDS_pept        complement(3710..4477)
FT                   /locus_tag="ACP_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871704"
FT                   /db_xref="GeneID:7698553"
FT                   /translation="MHLSLAARVLWAAGFTEQAALLLVLLLRKRFRAFPIFTIWIAFLV
FT                   LKNVVLFAVLGSLREYYYTYWLAEIIDLLLQIGVIYEICRNVLRPTGTWVRSALRSFLV
FT                   FGVAGIVLAAGLAWLAHPAESSFLGTWIERGRLFSSLITLELFVAMGFSSTRLGLVWRN
FT                   HVMAITTGWALWAAIGFAEELASAYHGPDYHGIVLDQIRIFSTQAVTVYWVAMFWLNEP
FT                   AERKLSPDMQIYLSNMQRRLESDAEILSNLRKP"
FT                   /protein_id="YP_002753158.1"
     atgcacctct ccttagcagc acgagttttg tgggcggctg gctttaccga gcaggccgcc        60
     ctgctgcttg tgctgcttct gcgcaagaga tttcgagcct ttcccatatt tacgatctgg       120
     atagcctttc tggtactgaa gaatgtggta ctcttcgcgg tcttgggatc gctgagagag       180
     tactactaca cctactggtt agcagaaatc attgacctgc tgctgcagat aggggtgatt       240
     tacgagattt gtcgcaacgt tctaaggccg acgggaacct gggtcagaag cgctttgcgc       300
     tcgtttctgg tgtttggggt cgcaggtatt gtcctcgcag cgggactggc atggctcgct       360
     catccggcag aatccagctt tctcggaaca tggattgaac gaggaaggct tttctcttcc       420
     ctgataacac tggaattatt tgtggccatg ggcttctcct ccacccggct ggggctggtt       480
     tggagaaatc atgtcatggc catcaccaca ggatgggccc tgtgggcagc catcggcttt       540
     gctgaagaac tggcgtcggc ctatcacgga ccggattacc acgggatcgt attagaccaa       600
     ataagaattt tcagtacgca ggcagttact gtatattggg ttgcaatgtt ctggttgaac       660
     gagccggcgg aacgtaagct gtctcctgac atgcagatct acctttccaa catgcagcgc       720
     aggttggaaa gtgatgcaga gattctttct aacttgagga agccttag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page