(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE6

ACIC5_1.PE6          Location/Qualifiers
FT   CDS_pept        complement(4515..4694)
FT                   /locus_tag="ACP_0006"
FT                   /gene_family="HOG000100622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871705"
FT                   /db_xref="GeneID:7697933"
FT                   /translation="MKKIARTAVLALVAMGAVAIATPAHAGIFGSEPMPPVNLPPHSSI
FT                   VGVVINAVIGSLGI"
FT                   /protein_id="YP_002753159.1"
     atgaagaaga ttgctcgcac cgccgttctc gccctggtcg ccatgggcgc tgtcgccatc        60
     gctacccccg cccatgcagg catctttggc agcgaaccca tgcctccggt taacctgccg       120
     ccccacagct cgatcgttgg cgtggtcatc aacgcggtca tcggcagcct tggaatctaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page