(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE9

ACIC5_1.PE9          Location/Qualifiers
FT   CDS_pept        complement(5695..7197)
FT                   /locus_tag="ACP_0009"
FT                   /gene_family="HOG000260707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF06824;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="GI:225871708"
FT                   /db_xref="GeneID:7701013"
FT                   /translation="MVKRTTHPRITEMKNDSSSLAPTPITRRDLLRGGMAASALAAFPL
FT                   AQYKAATWKMDQGRPPVGERKFQSPAIEAAIQRVKALIADPVLGRMFERCFPNTLDTTV
FT                   FPGSVNGKPDTFVITGDIDAMWLRDSSAQVHPYLPFARQDAGLARLLEGVVRRQTRMIL
FT                   IDPYANAFMRSTTDPPLSWSLHDRTTMKPGVAERKWEIDSLCYTVRLAHGYWQATGDTS
FT                   PFDAEWRQAAQSILTTFKQQQRLQGQGPYSFGRLTTNPYDTLALNGYGNVARPVGMIYS
FT                   MFRPSDDSCVYPLFVPANLFAVRALEQLQELAAKAAGAPGIAEQCESLLETVRAALRQY
FT                   GTVQHPEHGRIWAYEVDGYGNTLCMDDANVPSLLSLPYLGCCDSNDPLYQNTRRFVLST
FT                   ANPWYFEGSAAQGIGSPHTGRNAIWPMSLLIRALTSTHDEEIVACLRWLRNTTGGTGYM
FT                   HESFDASDPSQYTRPWFAWANTLFGELVLKLAHEKPSLLQQA"
FT                   /protein_id="YP_002753162.1"
     atggtcaaaa gaactaccca cccaaggatt accgagatga aaaacgattc ctccagcctc        60
     gctcccactc ccatcacacg ccgcgacctg ctgcgaggag gcatggcagc ttcggctctg       120
     gccgccttcc ctctggcaca atacaaggct gccacatgga agatggatca ggggcgtccc       180
     ccggtgggag aacgcaaatt ccagagcccg gccattgaag cggccatcca acgggtgaaa       240
     gctctcatcg ccgatccggt gctgggcaga atgtttgagc gctgtttccc gaatacgctc       300
     gacaccacgg tttttccggg gagcgtcaac ggcaagccgg atacatttgt catcaccggc       360
     gacatcgacg ccatgtggct gcgcgactcc tccgcgcagg tgcatcccta cctgcctttt       420
     gcccggcagg acgcaggtct ggcacgcctg ctcgaaggcg tggtgcggcg gcagacacgc       480
     atgatcctca tcgatccgta tgcgaacgca ttcatgcgtt ccaccaccga tccgccgctg       540
     agttggtcgc tgcacgaccg caccacgatg aagccgggcg tcgccgagcg caaatgggag       600
     atcgactcgc tctgttacac ggtgcgattg gctcatggat actggcaagc cacgggcgac       660
     acaagcccct tcgatgcgga atggagacag gccgcgcaaa gcattctcac caccttcaag       720
     cagcagcagc gcctgcaggg ccagggaccc tattccttcg gacggctcac cactaatccc       780
     tatgacacat tggcgctgaa cggctacggc aatgtggcgc ggcccgtcgg catgatttat       840
     tcgatgttcc ggccgtcgga tgattcctgc gtttatcccc ttttcgtccc ggccaaccta       900
     tttgcggtgc gcgctcttga gcagttgcaa gagctggcag caaaggctgc gggagcaccg       960
     ggcatcgccg aacaatgtga gagtctgctc gaaaccgttc gtgccgcgtt gcggcaatat      1020
     ggcacggtgc agcatccgga gcatggccgc atctgggcat atgaagtgga tggttacggc      1080
     aatacgttat gcatggatga tgcgaatgtt cccagtctgc tgagcctgcc ctatctgggg      1140
     tgctgcgact cgaacgaccc tctttaccaa aacacccggc ggtttgtgct cagtaccgcc      1200
     aacccctggt actttgaggg ctccgcagcc cagggcatcg gcagcccgca cacaggccga      1260
     aatgctatct ggccgatgag cctgctgatt cgagctttga cgtcaactca tgacgaggag      1320
     atcgttgcct gcctgcgatg gctgcggaac accaccggag gaaccggcta tatgcatgag      1380
     tcctttgacg cgagcgatcc gtcgcagtac acgcggccat ggtttgcctg ggcaaacact      1440
     ctctttggcg agctagtgct caaactggct catgaaaagc cgtcgttgct gcagcaggct      1500
     tag                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page