(data stored in ACNUC8465 zone)

HOGENOMDNA: ACIDO1_5

ID   ACIDO1_5; SV 1; empty ; DNA; empty ; PRO; 4309153 BP.
XX
AC   NC_015064;
XX
PR   Project: 50551;
XX
DE   Acidobacterium sp. MP5ACTX9 chromosome, complete genome.
XX
OS   Acidobacterium sp. MP5ACTX9
OC   Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae;
OC   Acidobacterium.
XX
RN   [1]
RP   1-4309153
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
RA   Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I., Rawat,S.R.,
RA   Mannisto,M., Haggblom,M.M. and Woyke,T.;
RT   "Complete sequence of chromosome of Acidobacterium sp. MP5ACTX9";
RL   Unpublished
XX
RN   [2]
RP   1-4309153
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (04-FEB-2011) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4309153
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Goodwin,L., Pitluck,S.,
RA   Teshima,H., Detter,J.C., Han,C., Tapia,R., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., Ovchinnikova,G., Pagani,I., Rawat,S.R.,
RA   Mannisto,M., Haggblom,M.M. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (24-JAN-2011) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002480.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4088693
CC   Source DNA and organism available from Max M. Haggblom
CC   (haggblom@aesop.rutgers.edu)
CC   Contacts: Max M. Haggblom (haggblom@aesop.rutgers.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Acidobacterium sp. MP5ACTX9
CC   collection_date     :: Missing
CC   lat_lon             :: Missing
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Missing
CC   environment         :: Acid mine
CC   num_replicons       :: 6
CC   ref_biomaterial     :: Missing
CC   biotic_relationship :: Missing
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Aerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   GOLD Stamp ID       :: Gi06612
CC   Funding Program     :: DOE-CSP 2010
CC   Gene Calling Method :: Glimmer
CC   Gram Staining       :: Gram-
CC   Phenotypes          :: Acidophile
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 30x
CC   Sequencing Technology    :: WGS
CC   ##Genome-Assembly-Data-END##
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4309153
FT                   /strain="MP5ACTX9"
FT                   /mol_type="genomic DNA"
FT                   /organism="Acidobacterium sp. MP5ACTX9"
FT                   /db_xref="taxon:696844"
FT   gene            28..1506
FT                   /db_xref="GeneID:10205793"
FT                   /locus_tag="AciX9_0001"
FT   CDS_pept        28..1506
FT                   /locus_tag="AciX9_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   aca:ACP_2123 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="GI:322433660"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:10205793"
FT                   /translation="MSFVPTATAVLNHWVRILGALEKKINRQSFETWLKPTRYSRTVGK
FT                   TLFVRIPSAQFEHIGDKYGDLIEEAIEKLGFEIESVTFETPQQDPTAPRVREDGGFGPM
FT                   PSHATNTPGGTNGNGAGNGATSGAIRQNGARGNAAPAAPSTEQARFDWNAASQLNPRYQ
FT                   FDAFVIGSGNQFAAAAAQAVAERPSKAYNPLFLYGGVGMGKTHLMHAIGHEVKRRMPHT
FT                   SISYVSGEKFTNEMINSVRYDKMTTFRDKFRNVDVLLIDDIQFLAGKERTQEEFFHTFN
FT                   ALHETMKQIVIASDRPPKELADFEDRLRSRFEWGLIADIQPPDLETKVAILQRKAEAES
FT                   TTLPTDVALFIASNVRTNVRELEGALIRVIAWCSHHGVECSLPVAQQCLKQFIDTQVRK
FT                   ITIEAIQRAVAEQFGMRVPELKQKNNSRQIVVPRQIAMYLAKQMTEASLPEIGRQFGGK
FT                   HHTTVMHSIAKIDEQRRADKDLNRTINKLMETLS"
FT                   /protein_id="YP_004215872.1"
FT   misc_feature    67..1503
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:178902"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    586..975
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    619..642
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    order(622..645,808..810,907..909)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    796..813
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    946..948
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    1231..1500
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="AciX9_0001"
FT   misc_feature    order(1300..1302,1324..1329,1348..1350,1366..1374,
FT                   1399..1413,1420..1422,1429..1434)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="AciX9_0001"
FT   gene            1619..2437
FT                   /db_xref="GeneID:10201975"
FT                   /locus_tag="AciX9_0002"
FT   CDS_pept        1619..2437
FT                   /locus_tag="AciX9_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_1959"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_1959 hypothetical protein"
FT                   /db_xref="GI:322433661"
FT                   /db_xref="GeneID:10201975"
FT                   /translation="MRRLLFVGTVAALMPLCGGVAGAQALPGVAELRARALESYQKSSA
FT                   ARERYICKELIRNDELNGNGEVKKSYLDEREIFYVNGFQISQEVSKNGRALNEGEIRKR
FT                   DENVRKQIEAASDHKRPKTQGLVISAGDVLRLAKLDHERRVMVAGRPTIVFDVVPDDDA
FT                   KASTVEEKLVAAMAGTVSIDEATGNLQDVNTTGAKDVKVGGGLVANVHKGFAMHILVAP
FT                   EPDGVWLLKLAEGTGEARIGLVTKSAMRFHQETEGCKLYDVDATQVDKKK"
FT                   /protein_id="YP_004215873.1"
FT   sig_peptide     1619..1690
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.663 at
FT                   residue 24"
FT                   /locus_tag="AciX9_0002"
FT   gene            3078..4271
FT                   /db_xref="GeneID:10201976"
FT                   /locus_tag="AciX9_0003"
FT   CDS_pept        3078..4271
FT                   /locus_tag="AciX9_0003"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: aca:ACP_2196 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:322433662"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10201976"
FT                   /translation="MPTLTEDSETNTNVAAPTGNLEITVSRAELLRELTAAQSVVERKT
FT                   TIPILSNFLFEASNEGETGRLTITATDLDQSLRTSCAAKVKKAGACTIPARKLYDYIRL
FT                   LPEGEISIKLMDNHWVQIRAGRSNTKMVGMARANFPQVAEFPASGAYTLSVASLKTMVS
FT                   KTIFAISNEESRYTLNGALLVLKAESMAMVATDGHRLAHVEKLGETLEGISGEKKTLIP
FT                   RKALSELSSLLNSTDAETMQFADDDSTLFFKMGGRVLTSRKLTGQFPNYEAVLPRDNNK
FT                   FVIVRSEDLMSAIQRVAQFADERSGAIKIRLEQNELRLSSSSTDSGESEDTIETPYNYD
FT                   PLVVGFNSQYLIDFLKAIGNTGEVRLEFKDAQSAGQMRPEDGNEDVKYRYILMPMRI"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_004215874.1"
FT   misc_feature    3138..4265
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="AciX9_0003"
FT   misc_feature    3141..4268
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:180180"
FT                   /locus_tag="AciX9_0003"
FT   misc_feature    order(3207..3209,3363..3365,3384..3386,3747..3749)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="AciX9_0003"
FT   misc_feature    order(3366..3368,3375..3377,3453..3455,3459..3461,
FT                   3972..3974,4065..4070)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="AciX9_0003"
FT   misc_feature    order(3660..3662,3666..3677,4116..4118,4254..4265)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="AciX9_0003"
FT   misc_feature    order(3660..3662,3666..3671,3897..3899,4002..4004,
FT                   4041..4046,4125..4127,4254..4265)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="AciX9_0003"
FT   gene            4437..5207
FT                   /db_xref="GeneID:10201977"
FT                   /locus_tag="AciX9_0004"
FT   CDS_pept        4437..5207
FT                   /locus_tag="AciX9_0004"
FT                   /gene_family="HOG000115862" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_5553"
FT                   /codon_start="1"
FT                   /product="peptidase M56, BlaR1"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_5553 peptidase M56, BlaR1"
FT                   /db_xref="GI:322433663"
FT                   /db_xref="InterPro:IPR017801"
FT                   /db_xref="GeneID:10201977"
FT                   /translation="MVKLEAWRWVAVTCFGLTAYGFSQEKATPLTFEVATVRLTKPGEL
FT                   DGWIKALPGGAEYTAHNIPVKLMISLMYKVPMRQISGGPDWMETDKYDVEAKADKSYSL
FT                   DDLHTMYRGLLAERFHLKVRKEIHEGPVYALTVDKGGVKMKPDLSEQSYAIPITYSGEG
FT                   AVGNRVPMSYLSWWLGQQLQSESRPVVDETGLKENFDFTLSFTPPRLEGTDGGAAEKPS
FT                   LFTAVKEQLGLKLEAQKGPVEYYVIEHIERPSAN"
FT                   /protein_id="YP_004215875.1"
FT   misc_feature    4524..5204
FT                   /note="Protein of unknown function (DUF3738); Region:
FT                   DUF3738; cl11887"
FT                   /db_xref="CDD:159641"
FT                   /locus_tag="AciX9_0004"
FT   gene            5242..6834
FT                   /db_xref="GeneID:10201978"
FT                   /locus_tag="AciX9_0005"
FT   CDS_pept        5242..6834
FT                   /locus_tag="AciX9_0005"
FT                   /gene_family="HOG000167948" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; GAF domain protein; PAS
FT                   fold-3 domain protein; histidine kinase A domain protein;
FT                   KEGG: aca:ACP_0498 sensory box histidine kinase/response
FT                   regulator; SMART: ATP-binding region ATPase domain protein;
FT                   GAF domain protein; histidine kinase A domain protein"
FT                   /db_xref="GI:322433664"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="GeneID:10201978"
FT                   /translation="MGSTNRPDSTAEDRRLEALRQFSILDTLPEQGYEDVTELASFICG
FT                   TPIALVSLVDAERQWFKSVRGLEARETPVSQSFCAYTVPTGETLIVTDARTDERFKNNP
FT                   LVLGDPNIRFYAGAPIVEANGYVLGTVCVIDTEPRELSAKQVRALEALARQVMSMMELR
FT                   KAIAAEAKATETTRLAQESAKIASWEWEVESGRLSWSGDSAWIYGRPAEELAHIDQVLP
FT                   CVHEEDLHVLQGSMADSLAGGGEFQNEFRVVWPDGSTHLIVGQGSTVLKASGEVARVVG
FT                   INRDVTQRRLTEEALRQSEKLAAVGRLASTIAHEMNNPLESVTNLLYLAMTSGTLSEEA
FT                   HTYLSTAERELRRVSAIANQTLRFHKQSSKPQRVSCEDLFESALLIHQGRIVNSGVAVQ
FT                   KRKRATETVLCFDGEIRQVLNNLLGNAIDAMSAGEGRLVIRSRNATDWVSGRKGLMLTV
FT                   ADTGAGMSAATQKRLFDAFFTTKGIGGTGLGLWVSKEIVERHGGALRVRSSQAEGHRGT
FT                   VFCLFLPFDAVAR"
FT                   /protein_id="YP_004215876.1"
FT   misc_feature    5326..5709
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    <5782..>6147
FT                   /note="putative diguanylate cyclase; Provisional; Region:
FT                   PRK09776"
FT                   /db_xref="CDD:182070"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    6145..6339
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    order(6163..6165,6175..6177,6187..6189,6196..6198,
FT                   6208..6210,6217..6219,6268..6270,6280..6282,6289..6291,
FT                   6301..6303,6310..6312,6322..6324)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    6181..6183
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    6484..6810
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    order(6502..6504,6514..6516,6523..6525,6613..6615,
FT                   6619..6621,6625..6627,6631..6636,6700..6711,6757..6759,
FT                   6763..6765,6787..6792,6796..6798)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    6514..6516
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AciX9_0005"
FT   misc_feature    order(6625..6627,6631..6633,6700..6702,6706..6708)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="AciX9_0005"
FT   gene            6913..7374
FT                   /db_xref="GeneID:10201979"
FT                   /locus_tag="AciX9_0006"
FT   CDS_pept        6913..7374
FT                   /locus_tag="AciX9_0006"
FT                   /gene_family="HOG000124209" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid345_3568"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_3568 hypothetical protein"
FT                   /db_xref="GI:322433665"
FT                   /db_xref="GeneID:10201979"
FT                   /translation="MRLGLGAGLLMAGGLLQGAAAQAVPQSITGRWRVERILPTHNVGC
FT                   WDAERAKTLVGSTLRYEQGRMTWQGGTVEVAEALSRTLSRRKYQDEYSVDLAELGIKAA
FT                   EVVEIDLQHEDADVTGATTEVPGDTVVMAGPGRIVVSACGVYFLAVRAR"
FT                   /protein_id="YP_004215877.1"
FT   sig_peptide     6913..6984
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 24"
FT                   /locus_tag="AciX9_0006"
FT   gene            7371..7859
FT                   /db_xref="GeneID:10201980"
FT                   /locus_tag="AciX9_0007"
FT   CDS_pept        7371..7859
FT                   /locus_tag="AciX9_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:HEAR0030"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: har:HEAR0030 putative pirin-related protein"
FT                   /db_xref="GI:322433666"
FT                   /db_xref="GeneID:10201980"
FT                   /translation="MKKLALVGLVLLMGCGPRLYSGKGVVAGSGGTLGNWSHPPAGCIR
FT                   DSAYQDEGQRSVATFLWKDLRILEPGPGYNDIWKNDTPIRLDLQRDGDGYTGVLRTFKQ
FT                   QLGWRIDKTACSEFEFTPHEGPAREPKGRPVLDGELKMDCAVAGGRLTANVSFKGCGY"
FT                   /protein_id="YP_004215878.1"
FT   sig_peptide     7371..7439
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.446 at
FT                   residue 23"
FT                   /locus_tag="AciX9_0007"
FT   gene            7923..8957
FT                   /db_xref="GeneID:10201981"
FT                   /locus_tag="AciX9_0008"
FT   CDS_pept        7923..8957
FT                   /locus_tag="AciX9_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Srot_2219"
FT                   /codon_start="1"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: srt:Srot_2219
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase-like protein"
FT                   /db_xref="GI:322433667"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:10201981"
FT                   /translation="MRSGLRVLGWMLIGVLAASAAGQAGTHSRHAGRVDTVTSGTRVLY
FT                   TFPQSNNSATPLYALVNGSLKTIDMTMYELVDTVFSADLVAACKRGVKVRVILDQNLEK
FT                   SSNTAAYNQLNKTTNCSAAWANPAFQATHQKSMIVDGTKLAIITLNLTTRYYTTSRDFA
FT                   LVETDAADIAAVEATFNADFKSTTSFAYQPGKGTDLIWSPTTATADLLGIINGATKTLL
FT                   VENEEMGAANVVSALEAACKRGVAVHVAMTNLTAYKTEFAALKAAGCGVHLYASTATGL
FT                   YIHAKVLVADYGLSTQMVYVGSINFSIPSMTDNRELGLYVSDATIVKALQTQVTTDYAG
FT                   APAL"
FT                   /protein_id="YP_004215879.1"
FT   sig_peptide     7923..7991
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.361 at
FT                   residue 23"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    8091..8486
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    order(8319..8321,8325..8327,8364..8366,8370..8372,
FT                   8403..8405)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    order(8319..8321,8325..8327,8340..8342,8361..8366,
FT                   8370..8372)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    8550..8936
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    order(8772..8774,8778..8780,8829..8831,8835..8837,
FT                   8868..8870)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   misc_feature    order(8772..8774,8778..8780,8793..8795,8826..8831,
FT                   8835..8837)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="AciX9_0008"
FT   gene            complement(8954..9523)
FT                   /db_xref="GeneID:10201982"
FT                   /locus_tag="AciX9_0009"
FT   CDS_pept        complement(8954..9523)
FT                   /locus_tag="AciX9_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /codon_start="1"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   rsl:RPSI07_3238 conserved hypothethical protein"
FT                   /db_xref="GI:322433668"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="GeneID:10201982"
FT                   /translation="MRMSSQAQTPDPTYDAQPSSPPTIRWPGLHQPSDAAIFASNEIVI
FT                   PAPIEAIWPWLIRAELWPTWYPYSANIHFISTSGPDLRDRTRFRWSKFGVPITSKVREF
FT                   EPLTRLAYDIHGIGVLAYQAWLLTPLPDGTTHVLTQEVQTGWLARIGKRIMPHRLEDKH
FT                   QHWLEALSVKAQSGPPAQPRPFLKES"
FT                   /protein_id="YP_004215880.1"
FT   misc_feature    complement(9014..9406)
FT                   /note="Ligand-binding SRPBCC domain of an uncharacterized
FT                   subfamily of proteins; Region: SRPBCC_4; cd07822"
FT                   /db_xref="CDD:176864"
FT                   /locus_tag="AciX9_0009"
FT   misc_feature    complement(order(9014..9016,9023..9031,9035..9043,
FT                   9047..9061,9095..9097,9101..9103,9107..9109,9113..9115,
FT                   9140..9142,9146..9148,9188..9190,9194..9196,9221..9223,
FT                   9227..9229,9257..9259,9263..9265,9269..9271,9275..9277,
FT                   9302..9304,9353..9358,9362..9370,9395..9397,9401..9403))
FT                   /note="putative hydrophobic ligand binding site; other
FT                   site"
FT                   /db_xref="CDD:176864"
FT                   /locus_tag="AciX9_0009"
FT   gene            9678..10295
FT                   /db_xref="GeneID:10201983"
FT                   /locus_tag="AciX9_0010"
FT   CDS_pept        9678..10295
FT                   /locus_tag="AciX9_0010"
FT                   /gene_family="HOG000167971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: xcv:XCV1693
FT                   TonB-like protein"
FT                   /db_xref="GI:322433669"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:10201983"
FT                   /translation="MFDDEKKLGSDKSLRTAAVSAVVHVLVIAGLVGVIHSSRVIAPYR
FT                   LPGTAKGTQLLTYFSPDGSASKAATPVVAKPKAVRKAVAEAKVTMPPQETAEAKVTVGS
FT                   SSTNGASGQGSGDISIALPQKFPWPRPALDSMGHGTKGDVVLDATIDEQGKIASLVVTQ
FT                   SVNATVDEAVLATVRAWVFTPAMKQGKPVASEQEFRFHYERG"
FT                   /protein_id="YP_004215881.1"
FT   misc_feature    10101..10286
FT                   /note="Gram-negative bacterial tonB protein; Region: TonB;
FT                   cl10048"
FT                   /db_xref="CDD:175073"
FT                   /locus_tag="AciX9_0010"
FT   gene            10832..13429
FT                   /db_xref="GeneID:10201984"
FT                   /locus_tag="AciX9_0011"
FT   CDS_pept        10832..13429
FT                   /locus_tag="AciX9_0011"
FT                   /gene_family="HOG000100642" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /codon_start="1"
FT                   /product="TonB-dependent receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; Cna B domain protein; KEGG: sus:Acid_3639
FT                   TonB-dependent receptor"
FT                   /db_xref="GI:322433670"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:10201984"
FT                   /translation="MDDKGGLLPKASLTVKNDAGGAAQTAITDAAGRFTLSGLVAGSYT
FT                   VQATAPGFNTITKNVRVTDGGTNEVSLSLSIGNLTDQVTVEANSQGSVAAALAPMDALL
FT                   EATSARTEITSAFIQNFTSPVADFGEAVEMAPGTFTTNGNGVGLGQSSTYFRGFPDGDY
FT                   DIDFDGIPFYDTNTPSHHSWAFFPSQFLGGIDFDRSPGTASTIGPTPFGGSIHLLSKQF
FT                   SPMQNVRGGFSYGSFNTKLFDGEYDSGNFGPAHKFNVNVDVHHLGSDGYQTFNHQTRNA
FT                   GDIQFQYRPSDKTTITGFSAVIWLDANTPNFAATRCQMYGAQAGYTCTGANAPFAGSGI
FT                   NFLLTNNSDPLLYLNNQYNYYHVPTDFEYVGVRSELGKGFTFSIKPYTYNYDNSEKYSN
FT                   AVPITDNAALVGTTYAPLNVKIANTCSTLVKSKYTCGVDKYNSYRKYGETSELTQVSHF
FT                   GIFRAGLWYEWANTNRHQYPADPLQNWLDAPLPNFAETFVTNSYQPFVEYQYHATPKLT
FT                   ITPGIKFAYYTIGTKQFADNGGKIGGLGSNNPAAFITNGGSYFSSLPSGDVNYRIRDNW
FT                   SMYGQVATGSIVPASGTFDFTQSATGTPVATLPKQQKNLTYQTGTVLKLKRVTFDFDYF
FT                   HIHFDSGYSSFTPIDTGEPVYYLQPPSVTQGIEGESNVYITHGLSLYLNASYNRAQYTG
FT                   NATVFCNTAAACLSSTPQLSIATPGGQRISNAPSDIETEGLTYQHRSWDAGAFNKRVGT
FT                   MSLDNSGFHNAGTIDPFTLTNVFLNYTIKSGTHFNQTKIRLSFNNIFDNHNITGDSFAT
FT                   KATPLLITANGNTYNNPFVSASPITPLSGADAVSILPGRSVMLSVTFGLSPKR"
FT                   /protein_id="YP_004215882.1"
FT   misc_feature    <10946..11056
FT                   /note="The M14 family of metallocarboxypeptidases (MCPs)
FT                   are zinc-binding carboxypeptidases (CPs) which hydrolyze
FT                   single, C-terminal amino acids from polypeptide chains, and
FT                   have a recognition site for the free C-terminal carboxyl
FT                   group, which is a key...; Region: Peptidase_M14_like;
FT                   cl11393"
FT                   /db_xref="CDD:187018"
FT                   /locus_tag="AciX9_0011"
FT   misc_feature    11039..13309
FT                   /note="Outer membrane receptor proteins, mostly Fe
FT                   transport [Inorganic ion transport and metabolism]; Region:
FT                   CirA; COG1629"
FT                   /db_xref="CDD:31816"
FT                   /locus_tag="AciX9_0011"
FT   misc_feature    11162..13234
FT                   /note="Porin superfamily.  These outer membrane channels
FT                   share a beta-barrel structure that differ in strand and
FT                   shear number.  Classical (gram-negative ) porins are
FT                   non-specific channels for small hydrophillic molecules and
FT                   form 16 beta-stranded barrels (16...; Region: OM_channels;
FT                   cl00284"
FT                   /db_xref="CDD:185882"
FT                   /locus_tag="AciX9_0011"
FT   gene            13504..14964
FT                   /db_xref="GeneID:10201985"
FT                   /locus_tag="AciX9_0012"
FT   CDS_pept        13504..14964
FT                   /locus_tag="AciX9_0012"
FT                   /gene_family="HOG000100345" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2727"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2727 hypothetical protein"
FT                   /db_xref="GI:322433671"
FT                   /db_xref="GeneID:10201985"
FT                   /translation="MFKRYVLGCLVMMLGVGSAGAQASAANAKVATVPVVMLSDLHFDP
FT                   FHDPVKVPLLVKAPLEEWDRILGGPDSAGQAAAFAAIQTQCKAKENPDSSYALLRSALL
FT                   AAKAQTPSVGFVMVSGDLLVHDLDCRYPASMKLEASAGDDQAVSAAFAEKTTVYVMKKV
FT                   EATFAAVPVYLALGNNDSRCNHNRLSLHDEYLKASAAAVVDGLRGVSAAEKTAAMGTYE
FT                   SAGYYAVTMPGVMSGTRLLVVDDIYMMPKYANCEADDQDQQGAQEQMVWLQKELEDART
FT                   KGMSVWLLGHLPPAVNPDSSLEKGDSFCTKGKVVRYQTTDDLATEMTAYADVLKLGVFG
FT                   HTHMDELHLLRGKDAGVPVKVVGSVSPVDGNVPSFTVGLVATASAKLMDYSVYEASNST
FT                   GVGTTWPKEYGFDETYHEPSFSAEPLSDLIGRLRADTSGKGEESRAYQTHFIKGSSGKK
FT                   LSGSWPGYVCGLDNATAKGFKACVCGAK"
FT                   /protein_id="YP_004215883.1"
FT   sig_peptide     13504..13575
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.546 at
FT                   residue 24"
FT                   /locus_tag="AciX9_0012"
FT   misc_feature    13606..14568
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:187208"
FT                   /locus_tag="AciX9_0012"
FT   misc_feature    order(13621..13623,13627..13629,13864..13866,14035..14040,
FT                   14374..14376,14524..14526)
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="AciX9_0012"
FT   misc_feature    order(13621..13623,13627..13629,13864..13866,14035..14037,
FT                   14374..14376,14524..14526)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="AciX9_0012"
FT   gene            complement(14972..17518)
FT                   /db_xref="GeneID:10201986"
FT                   /locus_tag="AciX9_0013"
FT   CDS_pept        complement(14972..17518)
FT                   /locus_tag="AciX9_0013"
FT                   /gene_family="HOG000135096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /codon_start="1"
FT                   /product="Smr protein/MutS2"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2271 MutS2 family protein; PFAM: Smr
FT                   protein/MutS2; DNA mismatch repair protein MutS domain
FT                   protein; SMART: DNA mismatch repair protein MutS domain
FT                   protein; MutS III domain protein; Smr protein/MutS2"
FT                   /db_xref="GI:322433672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="GeneID:10201986"
FT                   /translation="MTQLLPQIPSPLLESSSLALEWPRLRALIAAKAISPLGRAWTLAL
FT                   EPSTDLTWIIAQQTRTSELRSFLTGGGSFDFHGLFDPEALLAKARIDGTALESLEILTL
FT                   LNLTERVAAWRSLLAAAESARRLGPSIRALSEPLSYHDLAPLLRTLRGKIEPDGSLSDD
FT                   ASPELKRIRRAMESQHRAIEASLRRAARALREEGSTQSDRDDLITVRGERFVIPIKAEF
FT                   KRKVPGVIHGSSSSGQTVYVEPLETIEQNNELVRLLDEEQSEIHRILVALTRALAAQAH
FT                   VLSIGTIILAEVESHFIRARFAQDLDCTAPTFTPGLSLKSARHPLLELRMRAENLGAPG
FT                   PDSRTWVGTTDTPERKPTKPIPLTLALTTEARQLIISGPNTGGKTVSLKTTGLLALMAQ
FT                   AGLLVPAEEATFPLFTAIFADIGDAQSIERNLSSFSAHVVNVDHISRHADGHSLVLLDE
FT                   LGSATDPEEGAALAVAVAEHFLNLNAWTAITTHLTSLKVYAAQHTGVLNAAVGFDQATL
FT                   TPTYELRLGVPGASAGLNIAARLGMAPTIIASARAQMTTQQADIGAFLDQLHDQISAAT
FT                   SERVSLKRRTEEVATERARLETEGRAEQKQRTRELELKLKTLLEDFETQLKETVNEIED
FT                   KTVARKIQRDSALRMARVRREFSDQFSSTVLAHTAGADKNDIASPLARRALTPIKAGDY
FT                   VTLKSLRRQATVVRVIDEHNFEVSMGQMKMRVPRTDIADVEVIKVVTPAEAARRRGNIT
FT                   VQTASGAPLGDSDYTPREINVIGRTAAEAEDEVSRYIDKAFLSGLERVRIVHGTGMGVL
FT                   RRTLREFLKSHPHVATFAEASQQEGGQGATLVDLRQ"
FT                   /protein_id="YP_004215884.1"
FT   misc_feature    complement(14978..17449)
FT                   /note="recombination and DNA strand exchange inhibitor
FT                   protein; Reviewed; Region: PRK00409"
FT                   /db_xref="CDD:179009"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(15893..16564)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16364..16387)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(order(16046..16048,16145..16150,16253..16255,
FT                   16361..16369,16373..16378))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16253..16264)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16199..16240)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16145..16162)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16127..16138)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(16040..16060)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="AciX9_0013"
FT   misc_feature    complement(14978..15205)
FT                   /note="Smr domain; Region: Smr; cl02619"
FT                   /db_xref="CDD:186529"
FT                   /locus_tag="AciX9_0013"
FT   gene            17585..19639
FT                   /db_xref="GeneID:10201987"
FT                   /locus_tag="AciX9_0014"
FT   CDS_pept        17585..19639
FT                   /locus_tag="AciX9_0014"
FT                   /gene_family="HOG000245572" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.4.24.71"
FT                   /codon_start="1"
FT                   /EC_number="3.4.24.71"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_1491 PgPepO oligopeptidase; PFAM:
FT                   peptidase M13; Peptidase M13, neprilysin-like"
FT                   /db_xref="GI:322433673"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="GeneID:10201987"
FT                   /translation="MKLKMAAAVLSLLGGVGAGAQGTVLPVVQPLSAIPFSPVLDLTSL
FT                   DKTVDPCVDFYKFSCGGWMKKNPIPADQASWSVYHKLAIDNQQFLWGILKDDAVAKDRT
FT                   PVQQKVGDYYAACMNTPAIDALGMKPVEAGLARLDMITTREQAAHAIATLHHNVAGSFF
FT                   FGSGVGQDAVDSSTEIVEVGAGGLGLPDRDYYLKTDAKSVKLREQYVAYVQQLMTLAGE
FT                   PSEKASADAKAILTIETALATGSLTVVERRDPHKIYHMMTLAELGGLAPGIDWAGYFKT
FT                   QGAGAFTKLNVSQPEFMKAVQAELMTEPVEALKAYLKFHMLTAAAPYLSHPFVQANFDF
FT                   YSKTLRGVPTMPARWKTCTGGVDRMLGEALGQEFVRRTFSSEMKAKTRTMTEQIEAAMK
FT                   GEIEGLDWMSPETKVEAERKLHAIRNKIGYPDTWRDYSTLEVKPDDYAGDAVRAYRFED
FT                   ARNWNKLGKPVDLTEWGMTPPTVNAYFNPQMNDINFPAGVLQPPLYDAKEDDAPNYGNT
FT                   GATIGHELTHAFDDEGRQFDDKGNLRDWWTAADAKGFEQRIQCVRDQYAGYVVVDDIHI
FT                   NSKLTSGEDVADLGGTLLAYIAWKKETAGQKLMPINGFTPDQRFFVGMAQWACENERPE
FT                   NLRVSAATDPHSPGFARINGVVSNMPEFKNAFQCKAGQAMVHVPACRVW"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /protein_id="YP_004215885.1"
FT   sig_peptide     17585..17647
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.842 at
FT                   residue 21"
FT                   /locus_tag="AciX9_0014"
FT   misc_feature    17702..19633
FT                   /note="Predicted metalloendopeptidase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: PepO;
FT                   COG3590"
FT                   /db_xref="CDD:33390"
FT                   /locus_tag="AciX9_0014"
FT   misc_feature    19028..19633
FT                   /note="Peptidase family M13; Region: Peptidase_M13;
FT                   pfam01431"
FT                   /db_xref="CDD:144869"
FT                   /locus_tag="AciX9_0014"
FT   gene            20202..20543
FT                   /db_xref="GeneID:10201988"
FT                   /locus_tag="AciX9_0015"
FT   CDS_pept        20202..20543
FT                   /locus_tag="AciX9_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_7413"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_7413 hypothetical protein"
FT                   /db_xref="GI:322433674"
FT                   /db_xref="GeneID:10201988"
FT                   /translation="MVAGIAAYFAVHALARHGWWGDGSDFMPEVFQCLLPFIAFGTTVM
FT                   AGLSVLTGYGLLTRRSWGRPLAIIMAILSLIKIPLGTALGIYTLWVLGSKAGGAEYEGL
FT                   AAAEEGIRV"
FT                   /protein_id="YP_004215886.1"
FT   gene            complement(20660..21346)
FT                   /db_xref="GeneID:10201989"
FT                   /locus_tag="AciX9_0016"
FT   CDS_pept        complement(20660..21346)
FT                   /locus_tag="AciX9_0016"
FT                   /gene_family="HOG000275099" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_1798"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1798 hypothetical protein"
FT                   /db_xref="GI:322433675"
FT                   /db_xref="GeneID:10201989"
FT                   /translation="MKVMLFGGTGMVGQGALRECLLDPSIKEVVAITRSTVAQPIPTPS
FT                   PKLRQIIRKDLFDLDGLDDEFAAVDTCMFCLGVTSFRMKEDDYRHITYDLTLSVAKRFV
FT                   RVNPKVVFIYVSGAGTDSTGESKTMWARVKGETENDLLALPLRAAFMFRPGGIVPQHGI
FT                   KSKTAVYQVFYSILKPIMPLFERFFPKYVTTTDQLGGAMLRLAKKGVAQEGPPRRVLES
FT                   VDIARM"
FT                   /protein_id="YP_004215887.1"
FT   misc_feature    complement(<20843..21346)
FT                   /note="Predicted nucleoside-diphosphate-sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG0702"
FT                   /db_xref="CDD:31046"
FT                   /locus_tag="AciX9_0016"
FT   gene            21464..22453
FT                   /db_xref="GeneID:10201990"
FT                   /locus_tag="AciX9_0017"
FT   CDS_pept        21464..22453
FT                   /locus_tag="AciX9_0017"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.24"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: aca:ACP_2188
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase"
FT                   /db_xref="GI:322433676"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="GeneID:10201990"
FT                   /translation="MTGHVTRMRRMRRTEALRSLVRETHLRPESLIYPLFIVPGEGVRK
FT                   PISSMPGVFNVSVDEALKDAAECVELGLGGLLLFGLPPEKDEQGSGAWDEQGIMQTALR
FT                   AIKRESGLKSLVTIADVCLCEYTSHGHCGIVARDGEEYAVENDSSVRLIAKTAASLAEA
FT                   GADIVAPSDMMDGRVEAIRAALDEGGHQQTPIMSYAAKFASAFYGPFREAADSAPQFGD
FT                   RKTYQMDGANRREAMREIEQDLLEGADMILMKPAMPYLDVLKEARDRYEVPIGAYQVSG
FT                   EYSMLVAAFERGWLERERAIIESLLSLRRAGADFIVTYFAKEAGRALG"
FT                   /product="Porphobilinogen synthase"
FT                   /protein_id="YP_004215888.1"
FT   misc_feature    21506..22447
FT                   /note="Porphobilinogen synthase (PBGS), which is also
FT                   called delta-aminolevulinic acid dehydratase (ALAD),
FT                   catalyzes the condensation of two 5-aminolevulinic acid
FT                   (ALA) molecules to form the pyrrole porphobilinogen (PBG),
FT                   which is the second step in the...; Region: ALAD_PBGS;
FT                   cd00384"
FT                   /db_xref="CDD:88598"
FT                   /locus_tag="AciX9_0017"
FT   misc_feature    order(21533..21535,21605..21607,21614..21616,21899..21904,
FT                   21983..21988,22073..22081,22139..22141,22148..22150,
FT                   22166..22168,22175..22180,22232..22246,22316..22318,
FT                   22370..22372,22382..22384,22391..22393)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88598"
FT                   /locus_tag="AciX9_0017"
FT   misc_feature    order(21821..21823,21827..21829,21833..21835,21857..21859,
FT                   21974..21976,22064..22066,22082..22084,22091..22096,
FT                   22109..22111,22130..22132,22142..22144,22223..22225,
FT                   22292..22294,22301..22303,22418..22420)
FT                   /note="active site"
FT                   /db_xref="CDD:88598"
FT                   /locus_tag="AciX9_0017"
FT   misc_feature    order(22064..22066,22223..22225)
FT                   /note="Schiff base residues; other site"
FT                   /db_xref="CDD:88598"
FT                   /locus_tag="AciX9_0017"
FT   gene            22559..22900
FT                   /db_xref="GeneID:10201991"
FT                   /locus_tag="AciX9_0018"
FT   CDS_pept        22559..22900
FT                   /locus_tag="AciX9_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BMD_0418"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmd:BMD_0418 hypothetical protein"
FT                   /db_xref="GI:322433677"
FT                   /db_xref="GeneID:10201991"
FT                   /translation="MRRNLALILLFGWVPVALGVFLLSEFWLQQPFLTLGVIIGWFVAA
FT                   CGMIWWAGEFRCPRCRRRYGAVGSRKGVNLIWRGLFDSICNNCKLRKFENFNSEGSNPG
FT                   SLDRRMARD"
FT                   /protein_id="YP_004215889.1"
FT   sig_peptide     22559..22618
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.726 at
FT                   residue 20"
FT                   /locus_tag="AciX9_0018"
FT   misc_feature    22565..>22744
FT                   /note="Protein of unknown function (DUF2614); Region:
FT                   DUF2614; cl07936"
FT                   /db_xref="CDD:186715"
FT                   /locus_tag="AciX9_0018"
FT   gene            complement(22910..23443)
FT                   /db_xref="GeneID:10201992"
FT                   /locus_tag="AciX9_0019"
FT   CDS_pept        complement(22910..23443)
FT                   /locus_tag="AciX9_0019"
FT                   /gene_family="HOG000116058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF820"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   sus:Acid_5455 hypothetical protein"
FT                   /db_xref="GI:322433678"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="GeneID:10201992"
FT                   /translation="MATPVLIPVEQYLSTSYDPDCDYIDGEVQERNRGERPHSLMQLAL
FT                   SAIFYSNRRAWKVLPMPEQRVQTSATRFRIPDVCLIAASDPADPIVHIPPILCVEIISS
FT                   GQTLRHMQERTDDYLAMGVQQVWVLDPVRREAFIPSPSGVLQPSPDNLNVSGTPIELSW
FT                   TEILREYDDLAAGR"
FT                   /protein_id="YP_004215890.1"
FT   misc_feature    complement(22994..23389)
FT                   /note="Domain of unknown function (DUF820). This family
FT                   consists of hypothetical proteins that are greatly expanded
FT                   in cyanobacteria. The proteins are found sporadically in
FT                   other bacteria. They have been predicted to belong to the
FT                   PD-(D/E)xK superfamily of...; Region: DUF820; cd06260"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="AciX9_0019"
FT   misc_feature    complement(order(23090..23092,23102..23104,23144..23146,
FT                   23213..23215,23330..23332))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:99749"
FT                   /locus_tag="AciX9_0019"
FT   gene            23534..25003
FT                   /db_xref="GeneID:10201993"
FT                   /locus_tag="AciX9_0020"
FT   CDS_pept        23534..25003
FT                   /locus_tag="AciX9_0020"
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2857 dihydrolipoyl dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="GI:322433679"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:10201993"
FT                   /translation="MSDTIFDLVVVGGGPAGYTCGIRAAQLGLKVALIEKTDKLGGTCL
FT                   HWGCIPTKSLLFSAEIWDHLKHAANYGIDNVDAPKLNWDNLIKRKSDITNKHTKGLDFL
FT                   MKKNKITVFRGHGRLTGPAKDGIHTITVTDEDKASGRGKDAQAEGYTSQKVDEIKAKKV
FT                   VLSTGSDARMLPGYKADDTILTNMEILTLPAMPKSMVVIGSGAVGVEFASIFKSFGAEV
FT                   TIIEALPRLVNAEDEEISKELLRLYKKRGFEVFLSAKVEKIDKKDGGAVVTFTDSTGKQ
FT                   QTKTAEKVLVAVGRAPRTYDCGLDKVNIPLDRGFIMTNEWMETTEPGIYAIGDIVGGLP
FT                   QLAHVGAMCGVVVASKLAGKYARPVNRQRIPGCTYCDPQIGSVGLTEAQAKEKGYQVKV
FT                   GKFPFVGNSKATILDSHDGFVKVVSDAKYGEVLGVHIIGPQATEIIAECVTALELEATV
FT                   EEMMFTIHAHPTLSESLLDGFSSVEGMAINV"
FT                   /protein_id="YP_004215891.1"
FT   misc_feature    23537..25000
FT                   /note="dihydrolipoamide dehydrogenase; Reviewed; Region:
FT                   PRK06416"
FT                   /db_xref="CDD:180558"
FT                   /locus_tag="AciX9_0020"
FT   misc_feature    23549..>23656
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="AciX9_0020"
FT   misc_feature    24125..24370
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="AciX9_0020"
FT   misc_feature    24641..24958
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerization domain; Region: Pyr_redox_dim; pfam02852"
FT                   /db_xref="CDD:145812"
FT                   /locus_tag="AciX9_0020"
FT   gene            complement(25075..25440)
FT                   /db_xref="GeneID:10201994"
FT                   /locus_tag="AciX9_0021"
FT   CDS_pept        complement(25075..25440)
FT                   /locus_tag="AciX9_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_3930"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyn:Cyan7425_3930 protein of unknown function
FT                   DUF1400"
FT                   /db_xref="GI:322433680"
FT                   /db_xref="GeneID:10201994"
FT                   /translation="MTIQPPIPPAQTVAIPLTPEVRAAYQALYDANEALIENTTDPGFL
FT                   AALNDVSTNVGNILTKDNLYRIEANNALFQALQQQINSTNASLLALKKQIQAVASHVSE
FT                   AGTVLSAIDKVVSLATG"
FT                   /protein_id="YP_004215892.1"
FT   gene            complement(25493..26533)
FT                   /db_xref="GeneID:10201995"
FT                   /locus_tag="AciX9_0022"
FT   CDS_pept        complement(25493..26533)
FT                   /locus_tag="AciX9_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TGME49_002110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tgo:TGME49_002110 hypothetical protein"
FT                   /db_xref="GI:322433681"
FT                   /db_xref="GeneID:10201995"
FT                   /translation="MQNKLKRRTVEKLGRAASGCVVVLGLGLTLCTTGCLSPLNKHAVA
FT                   LSAATAPVVDGAAVAYNSAESIHDLRENYEAAQQFDAASPVYNPRKIQPLLNDHDIEIR
FT                   LSVLAAFQAYSRSLVEVTNNTDSPELDAASRSAGEGLSALGNSLAPSIENTLGIASTTA
FT                   TQTIVTTTTPGTTSTTSSLSTTPTPAISPAVRTGIETAVNALGQYLVSKKIKSQLPAIV
FT                   KTMDPNVTALCQLLEQDLDTLQSQEQLDFNYIINTQTLFLRSAGMDAQHPAIDPGVRRE
FT                   QIMQLPEIVRQQRSADMQLTALKASVVKLAMTHHALAAAAQDNNPESLKDKLSELEAAG
FT                   SNLGKF"
FT                   /protein_id="YP_004215893.1"
FT   gene            26645..27403
FT                   /db_xref="GeneID:10201996"
FT                   /locus_tag="AciX9_0023"
FT   CDS_pept        26645..27403
FT                   /locus_tag="AciX9_0023"
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.181"
FT                   /transl_table="11"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; manually
FT                   curated; KEGG: aca:ACP_2861 lipoate-protein ligase B;
FT                   TIGRFAM: lipoate-protein ligase B"
FT                   /db_xref="GI:322433682"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="GeneID:10201996"
FT                   /translation="MFFHLLSPGRISYAEGLAMQQRVSAARKAGQVGDTLILLEHPPVL
FT                   TLGRNSKRENVLATDALLASKGVELHEVNRGGDVTYHGPGQLVGYPIVDLRGDLPGKKG
FT                   PHLGPVDFVRLLEEVLIRTCGEFRVMTQRVKGRTGVWTLANGSLEERKIAALGVHVSQG
FT                   VTTHGFALNVTTDLRDFEWIVPCGITDRQVTSLELESPLEPVPTLAEALLCTSRNFGKV
FT                   FGRQVLAANSLEALLADGAASHLAETAGVP"
FT                   /product="lipoate-protein ligase B"
FT                   /protein_id="YP_004215894.1"
FT   misc_feature    26657..27316
FT                   /note="Biotin/lipoate A/B protein ligase family; Region:
FT                   BPL_LplA_LipB; cl14057"
FT                   /db_xref="CDD:187213"
FT                   /locus_tag="AciX9_0023"
FT   gene            27498..29135
FT                   /db_xref="GeneID:10201997"
FT                   /locus_tag="AciX9_0024"
FT   CDS_pept        27498..29135
FT                   /locus_tag="AciX9_0024"
FT                   /gene_family="HOG000281564" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02927"
FT                   /codon_start="1"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2354 putative dihydrolipoamide
FT                   acetyltransferase; TIGRFAM: 2-oxoglutarate dehydrogenase,
FT                   E2 component, dihydrolipoamide succinyltransferase; PFAM:
FT                   catalytic domain-containing protein of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein"
FT                   /db_xref="GI:322433683"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR014276"
FT                   /db_xref="GeneID:10201997"
FT                   /translation="MPTEVVMPQMGESITEGTLTKWLKKPGDPVERNEPLFEISTDKVD
FT                   AEIPSPAAGIMGEIKTPEGSTVQINTVVCTINEAGSAAAAAPAPADLKADSATPAAEAT
FT                   AAQEAAIPAPEPETEVSGGTEVAMPQMGESITEGTITKWLKNIGDTVARDEPIFEISTD
FT                   KVDAEIPSPVAGTLTEIRVKEGATVTVNTIVAVIGGAAGSKPKAAAPAAVAPAAPAAVA
FT                   AAPTQASQGETPRSSPLVRKIAGDNNIDLQQVSGSGSAGRITKADIMGHLDKPASTAAA
FT                   TPTTVQPSVSAVQSAPATTAPAKAAAPTQQLGELVPMTKMRSIIAKRMVESKQTSPHVH
FT                   TVFKVDMTRIVKLREREKNKYEQRNGTKLTYMPFITRAAVQALKKHPVVNAAIQGDAIF
FT                   YNKNIAIGIAVALEWGLIVPVIKGCEEKNFLGVARSIVDLAERARTKKLAPDEVSGGTF
FT                   TITNAGIFGEQFGTPIINQPQAAILGVGGLNKEALVLTDKDGQDTIAIRNVQRFTLGFD
FT                   HRIVDGADAGKFMSDFKAYLENWAEDIG"
FT                   /protein_id="YP_004215895.1"
FT   misc_feature    27504..27725
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    order(27594..27596,27615..27632,27642..27644)
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    27624..27626
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    27867..29114
FT                   /note="branched-chain alpha-keto acid dehydrogenase subunit
FT                   E2; Reviewed; Region: PRK11856"
FT                   /db_xref="CDD:183339"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    27867..28049
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    order(27957..27959,27978..27995,28005..28007)
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    27987..27989
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    28197..28307
FT                   /note="e3 binding domain; Region: E3_binding; pfam02817"
FT                   /db_xref="CDD:111687"
FT                   /locus_tag="AciX9_0024"
FT   misc_feature    28434..29123
FT                   /note="2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Region: 2-oxoacid_dh; cl02008"
FT                   /db_xref="CDD:174698"
FT                   /locus_tag="AciX9_0024"
FT   gene            complement(29199..30083)
FT                   /db_xref="GeneID:10201998"
FT                   /locus_tag="AciX9_0025"
FT   CDS_pept        complement(29199..30083)
FT                   /locus_tag="AciX9_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Fjoh_3583"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fjo:Fjoh_3583 hypothetical protein"
FT                   /db_xref="GI:322433684"
FT                   /db_xref="GeneID:10201998"
FT                   /translation="MLAIGFTLLLGAYLFGPGLIARLILGFAVPRKTLVQSRSEEVTRS
FT                   IVQAVVPFGIALVWARATGALQQSGHLTDLQTVFSGIYSTSFFDAHRQDFFSSLHAFCQ
FT                   MNLCLLLRLYLLVVLFALTLNLAIRNYSQLRARLPLGWQKALLATLVLPRVSEWHVLLS
FT                   EMLLPAGDFLDADVLTKSSVLYQGRIQDKMLGADGSLQSITLAKPRRFLRDEFEKAKEA
FT                   DPNVDREAYWRSIAGNLFVLMASDVINLNLKYIHRNPIDFRSSQEERIVLRRLLERLSN
FT                   DETDRDQTDRQAD"
FT                   /protein_id="YP_004215896.1"
FT   gene            complement(30084..30296)
FT                   /db_xref="GeneID:10201999"
FT                   /locus_tag="AciX9_0026"
FT   CDS_pept        complement(30084..30296)
FT                   /locus_tag="AciX9_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MYPU_6250"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpu:MYPU_6250 ABC transporter
FT                   permease/ATP-binding protein"
FT                   /db_xref="GI:322433685"
FT                   /db_xref="GeneID:10201999"
FT                   /translation="MNGREIERLLTMIDANIAANQTILKDEMLRFIESHEDQVVNELRA
FT                   HESADIPTSAGVMTIKLSDLRELVA"
FT                   /protein_id="YP_004215897.1"
FT   gene            complement(30435..31601)
FT                   /db_xref="GeneID:10202000"
FT                   /locus_tag="AciX9_0027"
FT   CDS_pept        complement(30435..31601)
FT                   /locus_tag="AciX9_0027"
FT                   /gene_family="HOG000034029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: aca:ACP_2355
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="GI:322433686"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:10202000"
FT                   /translation="MKAGTPLLPGATIGIFGGGQLGRMMAMAARGMGYRILVLDPDPGC
FT                   PARFIVDGCIEAGWDDSRGAAMLARGCDVVTLEIEQIGERSMASAATFCPVRPGGAMLA
FT                   IIQDRIEQKNWLTKHGFPVGEFRAVRSLDETRAAIAELGRCFCKSATGGYDGRGQGKVG
FT                   FSAEPVTEADVLGAWEALGEGPGVVEKAVHLEREISVMVARSPRGEVKVYPAAWNHHEN
FT                   QILDWSVIPAPIPPSMEAEAREIAYEIADTFQLEGLLAVEMFITQDGELLINELAPRPH
FT                   NSYHESERACVTSQFEQAIRAVCDLPLGDVEVVQPAAIANLLGDLWLNPDGSAREVCFD
FT                   KALAVPGVALHLYEKLKPRKGRKMGHLSAIGATAEQAIERVLRAKAAL"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /protein_id="YP_004215898.1"
FT   misc_feature    complement(30441..31577)
FT                   /note="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit; Reviewed; Region: PRK06019"
FT                   /db_xref="CDD:180352"
FT                   /locus_tag="AciX9_0027"
FT   misc_feature    complement(30729..31256)
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="AciX9_0027"
FT   gene            complement(31607..32104)
FT                   /db_xref="GeneID:10202001"
FT                   /locus_tag="AciX9_0028"
FT   CDS_pept        complement(31607..32104)
FT                   /locus_tag="AciX9_0028"
FT                   /gene_family="HOG000034141" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: aca:ACP_2356
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="GI:322433687"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="GeneID:10202001"
FT                   /translation="MPLVGVVMGSRSDYAVMKAAVDVLREFGVPYEAKVVSAHRTPELM
FT                   VEYAQTAIARGLRVIIAGAGGAAHLPGMIAALTVVPVLGVPVSATSLQGLDALLSIVQM
FT                   PKGVPVGTLAIGASGAANAGLLAVAMLATTDAELQQKLIARREATRDKVLGESLEEDEV
FT                   KA"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /protein_id="YP_004215899.1"
FT   misc_feature    complement(31646..32101)
FT                   /note="AIR carboxylase; Region: AIRC; cl00310"
FT                   /db_xref="CDD:153673"
FT                   /locus_tag="AciX9_0028"
FT   gene            complement(32158..32415)
FT                   /db_xref="GeneID:10202002"
FT                   /locus_tag="AciX9_0029"
FT   CDS_pept        complement(32158..32415)
FT                   /locus_tag="AciX9_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid345_4353"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_4353 hypothetical protein"
FT                   /db_xref="GI:322433688"
FT                   /db_xref="GeneID:10202002"
FT                   /translation="MAFESGVHRAAGVRRAMAKGPALEMRAMAVEFPEVLGQPGRLHHL
FT                   EQRVSRNEQGVQRMRGITAAFGTALTMMHFAISYFTGKHH"
FT                   /protein_id="YP_004215900.1"
FT   gene            complement(32604..32939)
FT                   /db_xref="GeneID:10202003"
FT                   /locus_tag="AciX9_0030"
FT   CDS_pept        complement(32604..32939)
FT                   /locus_tag="AciX9_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Paes_0284"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: paa:Paes_0284 50S ribosomal protein L11"
FT                   /db_xref="GI:322433689"
FT                   /db_xref="GeneID:10202003"
FT                   /translation="MAGRFVKGTTDEPEESTSLGRKGVRNPRFFKTFARKQFAEALPVI
FT                   VSVLLDKAKSGSVSHLKLLVELSGLEKDPDPKKMKPRGKSLEAILTEQWAKDKAEAALK
FT                   PATGGWR"
FT                   /protein_id="YP_004215901.1"
FT   gene            complement(33207..33788)
FT                   /db_xref="GeneID:10202004"
FT                   /locus_tag="AciX9_0031"
FT   CDS_pept        complement(33207..33788)
FT                   /locus_tag="AciX9_0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2372"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2372 hypothetical protein"
FT                   /db_xref="GI:322433690"
FT                   /db_xref="GeneID:10202004"
FT                   /translation="MSAALVILPVIQAMAEVASRPAAGPISATGAALRKGPHRLTLVRA
FT                   SAAVLPDAEERIRLRPSPELSFYRKYTEAMLKRYTKLSMEAGRAPSLLGRELFRGHVTN
FT                   YKVSSFDDVVIYVHDVENCVAKLGRGQQYLVRKIAMQGYTQQETAAMIGTNLKIVIKRY
FT                   VEAIDLLTRLFLDLGLLAPTVASKRVTEGQ"
FT                   /protein_id="YP_004215902.1"
FT   gene            34487..35683
FT                   /db_xref="GeneID:10202005"
FT                   /locus_tag="AciX9_0032"
FT   CDS_pept        34487..35683
FT                   /locus_tag="AciX9_0032"
FT                   /gene_family="HOG000100685" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2051 hypothetical protein"
FT                   /db_xref="GI:322433691"
FT                   /db_xref="GeneID:10202005"
FT                   /translation="MFSRLYAKWMFAWETALTTRDTNRIVRPVEWGFDWLPPLTTPMPG
FT                   ASDEAQMTALSAQIAAQSDEFFAYATPSDFRLEERHPQLFPTNVRPETLAQDADLKRKA
FT                   SSGKLKAASFLRFTSAASTPYPENDQVNARWYPASPEQEEKFRRLGKPRQAMIVMPQWN
FT                   ADAFSHNALCEIFNRFGISCLRLSKPYHDIRRPAELERSDYAVSANIGRTMAACRQAVV
FT                   DIRSCIDWLSQQGYEQFGVLGTSLGSCYAFIAAAHDARLNVCAFNHASTWFGDVVWTGQ
FT                   STRHVREALEQAGLTQITTREVFRAVSPMAYMDRFAANPKRVLVVHAKYDLTFLEEFSL
FT                   DVLKNFNEYGIDYVSRVLPCGHYTTGETPYKYIDAWYLGSFIHDAFKKLAFENLKPVS"
FT                   /protein_id="YP_004215903.1"
FT   gene            36049..37317
FT                   /db_xref="GeneID:10202006"
FT                   /locus_tag="AciX9_0033"
FT   CDS_pept        36049..37317
FT                   /locus_tag="AciX9_0033"
FT                   /gene_family="HOG000239403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /codon_start="1"
FT                   /EC_number="2.1.2.1"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2846 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="GI:322433692"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="GeneID:10202006"
FT                   /translation="MPIDLNATLSAADPEIAAQIENEVNRQHEGLEMIASENFVSRAVL
FT                   EAAGTVFTNKYAEGYPGKRYYGGCEFADVVEDLARSRAKKLFGAEHVNVQPHSGSQANA
FT                   ATCMTLLTPGDTILGLDLAHGGHLTHGHKLNFSGKLYKIAGYQVSKDTETVDYDELEAQ
FT                   AERERPKMIIGGGSAYPRQFDFPRLRAIADKVGAYLMVDMAHFAGLVAGGAHPSPIPHA
FT                   HVVTTTTHKTLRGPRAGMILCGQEFAAGIDRSVFPGQQGGPLMHIIAAKAVAFKEALQP
FT                   EFAQYATQTVTNAKVLAEAIAEKGFRIVSGGTDTHLMLVDVFQKGMLGSEAEHALGEAG
FT                   ITVNKNAIPYDTNPPMKPSGIRIGTPALTTRGMKEAEMLVIAGWIVRALEQRSDPAALA
FT                   KIRGEVLELAEQFPLYEYLRAQA"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /protein_id="YP_004215904.1"
FT   misc_feature    36085..37272
FT                   /note="Serine-glycine hydroxymethyltransferase (SHMT). This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). SHMT
FT                   carries out interconversion of serine and glycine; it
FT                   catalyzes the transfer of...; Region: SHMT; cd00378"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="AciX9_0033"
FT   misc_feature    order(36085..36087,36091..36093,36112..36117,36142..36144,
FT                   36157..36159,36211..36213,36265..36270,36292..36294,
FT                   36337..36339,36358..36360,36463..36468,36838..36840,
FT                   36892..36894)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="AciX9_0033"
FT   misc_feature    order(36154..36156,36214..36216,36244..36246,36343..36348,
FT                   36427..36429,36577..36579,36652..36654,36661..36663,
FT                   36736..36741,36757..36759,37132..37134)
FT                   /note="glycine-pyridoxal phosphate binding site; other
FT                   site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="AciX9_0033"
FT   misc_feature    order(36154..36156,36427..36429,36739..36741,37132..37134)
FT                   /note="active site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="AciX9_0033"
FT   misc_feature    order(36220..36222,36241..36243,36412..36414,36424..36426,
FT                   36430..36432,36814..36816,37084..37086)
FT                   /note="folate binding site; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="AciX9_0033"
FT   gene            37369..37845
FT                   /db_xref="GeneID:10202007"
FT                   /locus_tag="AciX9_0034"
FT   CDS_pept        37369..37845
FT                   /locus_tag="AciX9_0034"
FT                   /gene_family="HOG000070306" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_0844"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_0844 hypothetical protein"
FT                   /db_xref="GI:322433693"
FT                   /db_xref="GeneID:10202007"
FT                   /translation="MLAWMIAIPALGFMTGLRSMMPMAVLCWFAYLHHMPIHHSWAFWV
FT                   ASPISVGVFSVLAVGELIGDKLPMTPARTAIGPLVARICFGGLVGTIAAMSLRGAPVEG
FT                   LLLGVLGALAGSFLGYHIRIWLTKDFGWPDLIVALAEDIIAIVVSVYAMGIVTG"
FT                   /protein_id="YP_004215905.1"
FT   misc_feature    37399..>37644
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG3918"
FT                   /db_xref="CDD:33704"
FT                   /locus_tag="AciX9_0034"
FT   gene            complement(37914..39794)
FT                   /db_xref="GeneID:10202008"
FT                   /locus_tag="AciX9_0035"
FT   CDS_pept        complement(37914..39794)
FT                   /locus_tag="AciX9_0035"
FT                   /gene_family="HOG000283740" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF885"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xac:XAC2543 hypothetical protein"
FT                   /db_xref="GI:322433694"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="GeneID:10202008"
FT                   /translation="MRAPRVLVAVSMLSAVALATAQAPAMKPATAKPATTAKPAMTTAP
FT                   AAKTEDSNPAPISPFPQGPPSKPGLELKTIHTEDRKWREAQRGYVDPRRMNRIQPKELR
FT                   SVDAATQAKEYDHLKGVMAQLEKLPVAEMNESEKINLEIYRYQIESQMSGQYFKEWEKP
FT                   VSSLESFWANAQGTGERGFRTEQDYLNYLTWLADIPRYYDENIANMRAGLARGFTPPKI
FT                   TLNGRDQTIAPIAKATSADQTPFWKAFVHMPSTINTAEQARLRAEGKKVIESTVIPEYK
FT                   KLLPFWTDEYYPKTVTSIAATDLPDGKAYYKAQIKRYTTLDLSADDLHAFGIAEVAKIH
FT                   QEMLDTMVEAKFTGDFAAFQKFLRTDPQFYPKTKEELLGDVSYMMKEFDDKSDRYFGYQ
FT                   PRGRFGVHPVPDEVAPYQPAGFGGAGGFSINLYDLPSRPLYGMPALVLHEAAPGHSWAG
FT                   LIAREHADPDGFRGGGSAFGEGWALYCERLGTEMDMYHTPYEKFGMLSFQSWRASRLVV
FT                   DTGMHAMGWTREQGQQYLRDNTVLSEHDIEEEIDRYISWPGQALSYYMGMTEILKERKH
FT                   AQEVLGPKFNLRAFHDAILATGGLPLPVLDEYLEAWIKGGGIGPYPEMEK"
FT                   /protein_id="YP_004215906.1"
FT   sig_peptide     complement(39729..39794)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.715 at
FT                   residue 22"
FT                   /locus_tag="AciX9_0035"
FT   misc_feature    complement(37956..39491)
FT                   /note="Bacterial protein of unknown function (DUF885);
FT                   Region: DUF885; pfam05960"
FT                   /db_xref="CDD:147876"
FT                   /locus_tag="AciX9_0035"
FT   gene            complement(39963..40490)
FT                   /db_xref="GeneID:10202009"
FT                   /locus_tag="AciX9_0036"
FT   CDS_pept        complement(39963..40490)
FT                   /locus_tag="AciX9_0036"
FT                   /gene_family="HOG000167971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: aba:Acid345_0676
FT                   TonB-like protein"
FT                   /db_xref="GI:322433695"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:10202009"
FT                   /translation="MSSLKMASVVLHVVVVAALLYKVQGVAKAHRAKSVARVLVPYAPG
FT                   HTAAAQPPKPKIIRPKVEPKIALKEPEPPPPASGGDPTGEADVSVAMANFYPAPKPDLS
FT                   ELPHGTHGDIVVDVTIDEDGKVVYTHVDEGLGHGVDEAVLAVLQTWTFYPATKAGKPVA
FT                   SVQQLLFHFDRA"
FT                   /protein_id="YP_004215907.1"
FT   misc_feature    complement(39972..40169)
FT                   /note="Gram-negative bacterial tonB protein; Region: TonB;
FT                   cl10048"
FT                   /db_xref="CDD:175073"
FT                   /locus_tag="AciX9_0036"
FT   gene            40734..44015
FT                   /db_xref="GeneID:10202010"
FT                   /locus_tag="AciX9_0037"
FT   CDS_pept        40734..44015
FT                   /locus_tag="AciX9_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain-containing protein;
FT                   KEGG: aba:Acid345_3005 TPR repeat-containing protein"
FT                   /db_xref="GI:322433696"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="GeneID:10202010"
FT                   /translation="MQTSHLSSTLFLCFASFVSATLPAQQLPADVTVQKLPISPPPSSP
FT                   ASAASEYAGESAVVDRSELIYAMNADGTGYSEHSMAIRVQSEAAVRELGIVNVPFASAS
FT                   EKVEIQYVRVRRPDGTVLQTAVSAALEQPQAVTREAPFYSDLKQMQLPVKSLRAGDTLE
FT                   WKVRITRTKAEAPGQFWSQDTFVSQGIALSETLELRIPKDTSVNVWTNPALNLKPIEKV
FT                   DGNQHVYRWESKSLKPTTGPEAEAEKKRKEKELWTADQELDAKEGALPSVAWTTFKSWE
FT                   AVGAWYRGLEGDRMMPDDTLKAKVAELTAGKTTLEEKVRAVYGFVGPQVRYIGVAFGVG
FT                   RYQPHHAEEVLENQYGDCKDKHTLLAAMLTVLGLHPDAVLIGSGIRFNEAVPSPAAFNH
FT                   LITHVMIDGKETWLDTTAEVAPYRMLNSTIRDKQALVVPETGTAKLEKTPADPPFPSYQ
FT                   RLKAVGMLDQDGVSNSRLVLTVRGDDELVLRAVLHQIAPAQYDELTQRVSQSMGYGGTA
FT                   SHAEISRPEDTAGPLEMSYDYKREKAGDWNNYRIVAQLMPVSLPMVDEKDPPVQSIDLG
FT                   VPRILSSTAEMKLPSGWGVELPEAIHEKAAFATYDMSFRFDKGTLYSERKVVVLQQKIG
FT                   VKDWKSYKKWQDAVGLGGDPFIQLTRVDARTDHASGKEGGTSNGPPAPAVTNAEAVKLI
FT                   QQAFTAMRKMDVGEAQPLLDKAKGLNDQERLLWAGYGYLAELRGAEQEAATDYRKELSL
FT                   HPDSYQVYRSLVGSQLRSGKRKDAMETLRSWQTADTSDPAPAMQLSAMQLADGNASAAV
FT                   ETMNSSIAKLPEEKRTEPRVILALCQAEMKNGMEAKASASMLELLKTSEDSGVLNDAAY
FT                   FLSETGHELPASETAMHKALSQMNAETESWTLDESPQVLAQQTSLLIAAWDTMGWILFH
FT                   EGKLSEARSYVEAAWVNEGHAVVGEHLGDIQMAMGEFTLAIQTFELAKKGGGPASELNE
FT                   RQNNAKKAGGKSTSMDAGKELKELRTVKLGSSKGHDGAAEYKVLLADEKVVRVEATGAK
FT                   TVEGGAEMIEKMQLPQMFPKGSTARLAKSGLLDCYEETCAFIFKP"
FT                   /protein_id="YP_004215908.1"
FT   misc_feature    41637..>41855
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="AciX9_0037"
FT   misc_feature    42909..43205
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AciX9_0037"
FT   misc_feature    order(42909..42911,42915..42920,42927..42932,43017..43022,
FT                   43026..43031,43038..43043,43119..43124,43131..43136,
FT                   43143..43148)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AciX9_0037"
FT   misc_feature    order(42924..42926,42960..42962,42972..42974,42981..42983,
FT                   43026..43028,43062..43064,43074..43076,43083..43085,
FT                   43128..43130,43164..43166,43176..43178,43185..43187)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="AciX9_0037"
FT   misc_feature    <42972..43670
FT                   /note="putative PEP-CTERM system TPR-repeat lipoprotein;
FT                   Region: PEP_TPR_lipo; TIGR02917"
FT                   /db_xref="CDD:163072"
FT                   /locus_tag="AciX9_0037"
FT   gene            complement(44027..46171)
FT                   /db_xref="GeneID:10202011"
FT                   /locus_tag="AciX9_0038"
FT   CDS_pept        complement(44027..46171)
FT                   /locus_tag="AciX9_0038"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA topoisomerase III; PFAM: DNA
FT                   topoisomerase type IA central domain protein; TOPRIM
FT                   domain-containing protein; DNA topoisomerase type IA zn
FT                   finger domain protein; KEGG: drm:Dred_0974 DNA
FT                   topoisomerase III; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="GI:322433697"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003916"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="GeneID:10202011"
FT                   /translation="MRVFLAEKPSVAREIAQALGCTHKEQGFFRGKNDLVTWAIGHLVR
FT                   FAEPGEMNPAWGKPWRREALPMLPKDGGWLLIPEPRTEDQFNVVARLFGDKRITQIVNA
FT                   TDAGREGEAIFRRIYALSGASKPVLRFWTSSLTEEAIASALSHLRPAADYDNLASAALT
FT                   RAQLDWLIGMNHSRAATLHNSVTCSVGRVQTPTLAMIVRRHHEIAGFIKTFFYEVHADL
FT                   GEFVARAVNSQQKHDFEIKAEAETILRDVPSDTLATVTLVEVKKNRKAPPQLHNLGELQ
FT                   KEANRRFGFPADRTLAIAQSLYESKAITYPRSSSRHLSEDMVDGLPAVLKALRLGEERA
FT                   SYVKQALHRAQHGPALSKRFVDGSKLSDHHAIIPTAKPAPASLSGDERKVYTIVAERFL
FT                   AIFLPDKETEDTRIDLEIAKHPFRARGSRLIAPGWTVLTGNQDFENKAADAEDRQALPA
FT                   VKKGDELEVVESELVTKERKPPSRYTDATLLAAMETAGREIDDDELREAMKGRGLGTEA
FT                   TRAAIIQRLLDLAYVIRDGKQFEPTGKGIALIAQVLPHLASPELTGDMEAKLNLVEAGQ
FT                   LDAAEILAEVSESLRHEIPAVFRSKPMQAPDAPRITAGKDELLCPKCKAGLVTKRSTPN
FT                   ASAPFYGCARFHDGCNFTINTVVAKKTLTETNIKDLCSPTRHHTTKIIKGFTSKAGKKF
FT                   DAFLQLSSATDFKTEFVFPR"
FT                   /protein_id="YP_004215909.1"
FT   misc_feature    complement(44186..46171)
FT                   /note="DNA topoisomerase III; Provisional; Region:
FT                   PRK07726"
FT                   /db_xref="CDD:181093"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(45728..46171)
FT                   /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to topoisomerase III.
FT                   Type IA DNA topoisomerases remove (relax) negative
FT                   supercoils in the DNA by:...; Region:
FT                   TOPRIM_TopoIA_TopoIII; cd03362"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45842..45844,45848..45850,45854..45856,
FT                   46139..46141,46148..46153))
FT                   /note="active site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45812..45817,45821..45826,45845..45847,
FT                   45851..45853,46130..46132))
FT                   /note="putative interdomain interaction site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45848..45850,45854..45856))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(45845..45847)
FT                   /note="putative nucleotide binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(44390..45706)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45551..45613,45626..45706))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(44585..44590,44600..44602,44606..44611,
FT                   44618..44623,45236..45238,45260..45262,45272..45274,
FT                   45644..45646,45656..45658,45668..45670,45677..45682))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45566..45568,45578..45580))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(44738..44770,44858..44914,44918..44962,
FT                   45362..45403,45512..45538))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(44963..45025,45047..45070,45152..45190,
FT                   45209..45337,45341..45361))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(44555..44557,44621..44623,44627..44629,
FT                   44984..44986,44996..44998,45005..45007,45065..45067,
FT                   45308..45316,45326..45328))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(45065..45067,45236..45238,45242..45244))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   misc_feature    complement(order(44390..44506,44516..44557,44567..44641,
FT                   44690..44737))
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="AciX9_0038"
FT   gene            46312..47112
FT                   /db_xref="GeneID:10202012"
FT                   /locus_tag="AciX9_0039"
FT   CDS_pept        46312..47112
FT                   /locus_tag="AciX9_0039"
FT                   /gene_family="HOG000167590" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_2539"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_2539 hypothetical protein"
FT                   /db_xref="GI:322433698"
FT                   /db_xref="GeneID:10202012"
FT                   /translation="MMGRFGIALLLVLGASVGILRGQGTAAPGAIGDAPLLPEYREAPL
FT                   PPAYGGVQVRIPGIYVTPVVNAPFTAKVQIVSQEQLPDGTVRVRKTVNHIARQSSGRIY
FT                   NERRQLVAPTFQGEPRLISAHIYDPSTRLNTYLNPVTHIAQEIRMKQAAVAPNYGTTRM
FT                   GVGKNPLLKEEELGEQALGPVMLRGIRRSRTVPAAVSGTGKDVVVVDEYWYSAELEIYM
FT                   IIKHNDPRTGEQIVAVSDVERGEPDGKQFVVPGNYKRVDETPVD"
FT                   /protein_id="YP_004215910.1"
FT   sig_peptide     46312..46392
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.712 at
FT                   residue 27"
FT                   /locus_tag="AciX9_0039"
FT   gene            complement(47131..47367)
FT                   /db_xref="GeneID:10202013"
FT                   /locus_tag="AciX9_0040"
FT   CDS_pept        complement(47131..47367)
FT                   /locus_tag="AciX9_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sala_0857"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sal:Sala_0857 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="GI:322433699"
FT                   /db_xref="GeneID:10202013"
FT                   /translation="MMLTTIRIRVLHGIEELILDQPGVTSIPALGDSVSCFGTRAIVTG
FT                   STIVHTPEGHRSILLHAEMQSRILNAWSRLYSA"
FT                   /protein_id="YP_004215911.1"
FT   gene            47772..48392
FT                   /db_xref="GeneID:10202014"
FT                   /locus_tag="AciX9_0041"
FT   CDS_pept        47772..48392
FT                   /locus_tag="AciX9_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_0458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_0458 hypothetical protein"
FT                   /db_xref="GI:322433700"
FT                   /db_xref="GeneID:10202014"
FT                   /translation="MPALGLVWLLAMVPGVRYLLAYEHTAGSQGTAPRGWPKGMPQVGD
FT                   AALPTLVVALHPRCSCSQATLAELEEAAQGFGHPYNAVLLIYRPKGSDYEWQKVDLYRD
FT                   AQKALHARVMLDDDGQYSAAFGAETSGEVLYYSAAKGAAGRRLLFSGGVTGSRGMVGGN
FT                   DGIEALKSAFKLDREPEHAKTPVFGCGLFAALEPQAAEKRSRP"
FT                   /protein_id="YP_004215912.1"
FT   gene            48389..50395
FT                   /db_xref="GeneID:10202015"
FT                   /locus_tag="AciX9_0042"
FT   CDS_pept        48389..50395
FT                   /locus_tag="AciX9_0042"
FT                   /gene_family="HOG000167947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   pca:Pcar_2937 signal transduction protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="GI:322433701"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:10202015"
FT                   /translation="MNPSILSSERVTSVNVAKEAERLFRSEHRLVCTRTDRLFAILMSL
FT                   QWPAAVAAALLISSRTWVGGTSSVHPHLIAAVYLGGLITVPPVLLAFFRPGERYTRHII
FT                   AACQMLMSGLLIHVSGGRIETHFHVFGSLAFLAFYLDWEVLATATLVTLVDHLAMGYYL
FT                   PASIFGTATASHWRLLEHVLWVVFFDIFLITSCVQGLKWLHAVARREADQELLLYQAYH
FT                   DALTGLGNRLQIQKLMGELLMPGSKEPRPFALMAIDLDRFKEVNDTLGHQVGDELLRQV
FT                   SQRLMAQIRKNDTLVRMGGDEFALVLDGCTSARVAESIAGRMVESLNKPFSLGDHTARI
FT                   GASIGICLHLDEGQDATDLFHHADLALYKVKNSGRNSFMVFDENMRAETLHQMSMEHRL
FT                   RSAVLENQMHLHYQPIVSTEGRLLGFEALLRWNDAVHGDVSPVDFIPLAEKTGLIIPLG
FT                   AWVLQQACSQAAQWHRTGNKLMKMSVNVSSIQLAHKDFVTTVLTALKETGLPAELLDLE
FT                   LTESALIQQHDSSYESLHLLRRFGVKLSIDDFGTGYSSLSYLRDLPVHTLKIDRAFVKD
FT                   IEISPESRTLVEGMIDMAHTLHLRVVAEGVENRKQMEILVEAGCDEIQGFHISKAVPAD
FT                   DARRFINVSHGEPEIKAMAGAAKVRGLAEVLAR"
FT                   /protein_id="YP_004215913.1"
FT   misc_feature    49049..49522
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AciX9_0042"
FT   misc_feature    order(49160..49162,49289..49291)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AciX9_0042"
FT   misc_feature    order(49175..49177,49184..49189,49199..49201,49211..49213,
FT                   49277..49279,49283..49294)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AciX9_0042"
FT   misc_feature    order(49265..49267,49352..49354)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="AciX9_0042"
FT   misc_feature    49577..50296
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="AciX9_0042"
FT   gene            50466..50993
FT                   /db_xref="GeneID:10202016"
FT                   /locus_tag="AciX9_0043"
FT   CDS_pept        50466..50993
FT                   /locus_tag="AciX9_0043"
FT                   /gene_family="HOG000020479" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aca:ACP_0848 cupin domain protein"
FT                   /db_xref="GI:322433702"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10202016"
FT                   /translation="MAEATAVPADDLQRYLKLAQPDGDVKLPHLGVVGDTYTLLLTGKD
FT                   TAGRLSLIDMHVPPGGGPPPHRHDFEETFIVLDGELSAIFRGQKMAVKAGETVHIPSNA
FT                   PHQFHNSSDKPVRMLCICSPAGQEEMFLEIGVPVATRTTAPPPLSEDEQKAFRAQAEAL
FT                   APKYKTELLAHA"
FT                   /protein_id="YP_004215914.1"
FT   misc_feature    50628..50831
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="AciX9_0043"
FT   gene            51033..51971
FT                   /db_xref="GeneID:10202017"
FT                   /locus_tag="AciX9_0044"
FT   CDS_pept        51033..51971
FT                   /locus_tag="AciX9_0044"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sus:Acid_4915 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:322433703"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:10202017"
FT                   /translation="MLKKIAGVMLMGVVSALAQTNAVRNTPRTILVHAHRGGRALRPEN
FT                   TIPSFQHGIDVGADVLELDLAVTKDGVLVVSHSPYLTYPVDTDVAKERVCDGPALPPGT
FT                   AIHTLTLAQLKQYDCGLHPLKRFPKQMAVPHTTIPTFDEVLELAPQGTFQFNVETKIYP
FT                   NHPELTPAPEAFVKMIDDAVKRRHLQARVILQSFDFRTLHAMRAIDPAIRLSALFEAKD
FT                   DGFTGIADQDKSFAHIAKVSGAEILSPDQTLVTPEAVATAHAMGRQVAPFTVNTSEGWQ
FT                   KMADAKVDAIISDDPVALLAWLRAQNPPLHP"
FT                   /protein_id="YP_004215915.1"
FT   sig_peptide     51033..51089
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.937 at
FT                   residue 19"
FT                   /locus_tag="AciX9_0044"
FT   misc_feature    51120..51920
FT                   /note="Catalytic domain of phosphoinositide-specific
FT                   phospholipase C-like phosphodiesterases superfamily;
FT                   Region: PI-PLCc_GDPD_SF; cl14615"
FT                   /db_xref="CDD:187391"
FT                   /locus_tag="AciX9_0044"
FT   misc_feature    51135..51920
FT                   /note="Glycerophosphoryl diester phosphodiesterase family;
FT                   Region: GDPD; pfam03009"
FT                   /db_xref="CDD:145909"
FT                   /locus_tag="AciX9_0044"
FT   misc_feature    order(51135..51137,51216..51218,51222..51224,51504..51506,
FT                   51621..51623,51846..51848)
FT                   /note="active site"
FT                   /db_xref="CDD:176498"
FT                   /locus_tag="AciX9_0044"
FT   misc_feature    order(51135..51137,51261..51263)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176498"
FT                   /locus_tag="AciX9_0044"
FT   gene            complement(51989..52642)
FT                   /db_xref="GeneID:10202018"
FT                   /locus_tag="AciX9_0045"
FT   CDS_pept        complement(51989..52642)
FT                   /locus_tag="AciX9_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   clj:CLJU_c15620 hypothetical protein"
FT                   /db_xref="GI:322433704"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="GeneID:10202018"
FT                   /translation="MAPKPKSRQAPQIDHDILTEDFAAQLDSGAVHDALAADTTLPPFV
FT                   SPRGQSARLDRCLWRNVTLTAPNARGLRLYDTQIEGSDLANLDLTGGHLERVEITGTRL
FT                   TGATFTEAQLKSVLFRECKLDLAFFRMARLQHCVFERCNLTDADLYNADLTGTIFKDCD
FT                   LSRAELSHAKLIQADVRDCRLDGLRGTPADMAGLMISPDQAPQLITLFGVKVKW"
FT                   /protein_id="YP_004215916.1"
FT   misc_feature    complement(52055..>52489)
FT                   /note="Pentapeptide repeats containing protein [Function
FT                   unknown]; Region: COG1357"
FT                   /db_xref="CDD:31548"
FT                   /locus_tag="AciX9_0045"
FT   misc_feature    complement(52100..52219)
FT                   /note="Pentapeptide repeats (8 copies); Region:
FT                   Pentapeptide; pfam00805"
FT                   /db_xref="CDD:109845"
FT                   /locus_tag="AciX9_0045"
FT   gene            complement(52652..52978)
FT                   /db_xref="GeneID:10202019"
FT                   /locus_tag="AciX9_0046"
FT   CDS_pept        complement(52652..52978)
FT                   /locus_tag="AciX9_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dana_GF11791"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dan:Dana_GF11791 GF11791 gene product from
FT                   transcript GF11791-RA"
FT                   /db_xref="GI:322433705"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="GeneID:10202019"
FT                   /translation="MRPRLHCSRLGLERKNAINCDGLTLLLAVSMTSTGTYNFDDNFTV
FT                   FLDIFNNFNGQVFTVLQRKNAHRTYFGFVQPLRNFGTWHLPISIAVSTAMNRCQCLFQH
FT                   SHAM"
FT                   /protein_id="YP_004215917.1"
FT   gene            53048..53449
FT                   /db_xref="GeneID:10202020"
FT                   /locus_tag="AciX9_0047"
FT   CDS_pept        53048..53449
FT                   /locus_tag="AciX9_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ESA_01683"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_01683 hypothetical protein"
FT                   /db_xref="GI:322433706"
FT                   /db_xref="GeneID:10202020"
FT                   /translation="MTAGSLTLFILLANKPYGIQEASVVEYTLFEIFLTFAATRSLRRY
FT                   LFTCPAVRPQIPRLLWRHLGYVITLVIFQAVMLAARPNLSSWWNTPDKKGSTPFEIALF
FT                   FLCFGIGYAQVLGSRSILERAHQDFSTPG"
FT                   /protein_id="YP_004215918.1"
FT   gene            53602..55092
FT                   /db_xref="GeneID:10202021"
FT                   /locus_tag="AciX9_0048"
FT   CDS_pept        53602..55092
FT                   /locus_tag="AciX9_0048"
FT                   /gene_family="HOG000261989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01229"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 39"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 39; KEGG:
FT                   aca:ACP_1578 glycosyl hydrolase, family 39"
FT                   /db_xref="GI:322433707"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="GeneID:10202021"
FT                   /translation="MRQFWLKGLLLGAAACATGVGHAQETVVVDAHAAAKPFPHFWEQM
FT                   FGSGRAILTLRESYRDDVKAVKKVADFKYVRFHAIFHDEVGVYNEDEHGNPVYNFAYVD
FT                   AIYDGLLKNGVKPMVEISFMPKKLAFPDALHPFWYKQNVSPPKSMEKWDGLIHAFTQHL
FT                   IDRYGVDEVASWYFEVWNEPNIDFWNGIPRLESYFELYDHTARDIKAVNPRLRVGGPAT
FT                   AAAQWVPEFLAHVAENHVPIDFVTTHGYGDDTVENMFNTHEKIAVDDRVGRAVAKVRGE
FT                   INKSPLPKLPLYWTEWNVPGLMQSRDTTYVGPALANTVREADGNVDMLSFWTFSDVFEE
FT                   GGPTTTPFRGDFGLRAFDGINKPSYYAYGLLHELGPQRIANKSDNVIVTKDADGGLALV
FT                   AWNLVDPDQHGSDRTMELEFKGVAKDAKVTIERVDNEHGNVLPKWAAMGKPLNPTPTQA
FT                   TQLNEETAMPAPEQTTLVNGRLKLELEQNALVLVKVAR"
FT                   /protein_id="YP_004215919.1"
FT   sig_peptide     53602..53673
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 24"
FT                   /locus_tag="AciX9_0048"
FT   misc_feature    53680..55083
FT                   /note="Glycosyl hydrolases family 39; Region:
FT                   Glyco_hydro_39; cl10042"
FT                   /db_xref="CDD:127355"
FT                   /locus_tag="AciX9_0048"
FT   gene            complement(55098..56762)
FT                   /db_xref="GeneID:10202022"
FT                   /locus_tag="AciX9_0049"
FT   CDS_pept        complement(55098..56762)
FT                   /locus_tag="AciX9_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tpau_4105"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tpr:Tpau_4105 putative mannosyltransferase"
FT                   /db_xref="GI:322433708"
FT                   /db_xref="GeneID:10202022"
FT                   /translation="MLALSFAVPLLVLCAYWFFFIRADYYPSRDEFSLLVASTKMFHPA
FT                   ISTWFLEGYSRYFLSYPGLSHPATDFIRPGANLAYYVNSLLFGANWSCYLLLSYFIQAG
FT                   LVCITVKLALEALKLPRSLAVFAGVAVLLAPSFGWEQIYIPSFTIDLLGAFFVMLALHE
FT                   LWRSRNVTAWLLLAAAIFTKETTLFAPVMTALAVWLPIGKPSSIGRRFTASILWLTPIF
FT                   VWMLLRHFAFHGGAGIYVFQNMALKGTLMNVLHGFLAWPFGTRSMQQSVRYRSLFFMLN
FT                   AAFWAAVFFAVVRWRRGKASSEASSEITCMPALLLFSIGAMAMPVLLNLPQRFGASLYP
FT                   LLFLTLATIAHAASDLTIRRLAVGALAASTLVAIYQKATDPLTLKESRAEWTLSRNYIQ
FT                   SIHAVRSPYLLLVDDSSGGFAAPDLVARFADFHGTLMRSNNIEGLMLDHCAGQPTVTKT
FT                   SADEGHLALTSTLTPPCGYYAFDSLSPRELERGTDGLVTHPNDRVTLRIVPPALQPLPP
FT                   SATPEMWGNLTVSLTSPVKDTVVLVPDLNTLTYHQLK"
FT                   /protein_id="YP_004215920.1"
FT   gene            56918..57145
FT                   /db_xref="GeneID:10202023"
FT                   /locus_tag="AciX9_0050"
FT   CDS_pept        56918..57145
FT                   /locus_tag="AciX9_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:FB2170_02290"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fbc:FB2170_02290 hypothetical protein"
FT                   /db_xref="GI:322433709"
FT                   /db_xref="GeneID:10202023"
FT                   /translation="MRLIFRSLLAAALCLLAVPVISAQTIRVSYPDARSAKPLDGRLLL
FT                   LLSNDPSEDPRMQINDTQKSQQVFGMTVDG"
FT                   /protein_id="YP_004215921.1"
FT   sig_peptide     56918..56986
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.724 at
FT                   residue 23"
FT                   /locus_tag="AciX9_0050"
FT   gene            57160..58647
FT                   /db_xref="GeneID:10202024"
FT                   /locus_tag="AciX9_0051"
FT   CDS_pept        57160..58647
FT                   /locus_tag="AciX9_0051"
FT                   /gene_family="HOG000252249" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Slin_1343"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sli:Slin_1343 hypothetical protein"
FT                   /db_xref="GI:322433710"
FT                   /db_xref="GeneID:10202024"
FT                   /translation="MMIGENAQGYPRASLKDVPPGEYTVQAVLNVYETFQRGDGKMVKL
FT                   APDRGEGQHWNLAPGNLMSKPRKVKIGPGTMPITVSLDQVIPPNVPEKDTKYIRHIKVQ
FT                   SALLTRFWGRPMFLSAVVLVPEGFDTHTEAHYPLVIFHDHFVSGFSDFRETPPDAKLKA
FT                   DYSERFHLAGYNRIQQEEAYKNYKDWVAPNKPRMLIIKIQHANAYYDDSYAVNSENLGP
FT                   YGDAIETELIPAVEKEFRALGQGWARFVYGGSTGGWESLAVQMFYPEHYNGAFVACPDP
FT                   VDFHAFMTADLYKQDNLFYEQGANKRVEQPAMRNYLGQTLISMRDNVAYEAALGDSARS
FT                   GDQFDIWQAVYSPVGADGYPRPIFNKTTGTIDHTTAEYWRQHYDLNAILQRDWTKLGPK
FT                   LQGKIHLYVGSDDTYFLNNAVYLMEDFLKETGTPGHGVAYDGEVKYGPRAEHCWNGDPE
FT                   KPNWYSRLHYNQMYVPMILDRIAKTAPAGADVTSWKY"
FT                   /protein_id="YP_004215922.1"
FT   gene            complement(58651..59421)
FT                   /db_xref="GeneID:10202025"
FT                   /locus_tag="AciX9_0052"
FT   CDS_pept        complement(58651..59421)
FT                   /locus_tag="AciX9_0052"
FT                   /gene_family="HOG000017142" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /codon_start="1"
FT                   /product="glutamine cyclotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   cak:Caul_1498 glutamine cyclotransferase"
FT                   /db_xref="GI:322433711"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="GeneID:10202025"
FT                   /translation="MFARCFSLALVMFLSTLSAGCQSAPVQSYKVVRTYPHSTASYTEG
FT                   FFYLNGLFYEGTGLTGHSQLLVVKPETGKPVQQLDLPPELFGEGIVDWGPNLYEWTWKS
FT                   HTCFVYDRATLHKIGQLSYDGEGWGMTRDEHNLITSDGSTRLSFRDPASFKVVRQIAVK
FT                   DGAEAVSQLNELEYIHGEIYANVWHSDRIARISPQDGHVIAWIDLTGLLPADQRVDAES
FT                   VLNGIAYDAQHDRLFVTGKQWPKIFEIKALPKTK"
FT                   /protein_id="YP_004215923.1"
FT   sig_peptide     complement(59350..59421)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.950 at
FT                   residue 24"
FT                   /locus_tag="AciX9_0052"
FT   misc_feature    complement(58663..59418)
FT                   /note="Glutamine cyclotransferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region:
FT                   COG3823"
FT                   /db_xref="CDD:33616"
FT                   /locus_tag="AciX9_0052"
FT   gene            complement(59460..59903)
FT                   /db_xref="GeneID:10202026"
FT                   /locus_tag="AciX9_R0001"