(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE1

ACIDO1_5.PE1         Location/Qualifiers
FT   CDS_pept        28..1506
FT                   /locus_tag="AciX9_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   aca:ACP_2123 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="GI:322433660"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:10205793"
FT                   /translation="MSFVPTATAVLNHWVRILGALEKKINRQSFETWLKPTRYSRTVGK
FT                   TLFVRIPSAQFEHIGDKYGDLIEEAIEKLGFEIESVTFETPQQDPTAPRVREDGGFGPM
FT                   PSHATNTPGGTNGNGAGNGATSGAIRQNGARGNAAPAAPSTEQARFDWNAASQLNPRYQ
FT                   FDAFVIGSGNQFAAAAAQAVAERPSKAYNPLFLYGGVGMGKTHLMHAIGHEVKRRMPHT
FT                   SISYVSGEKFTNEMINSVRYDKMTTFRDKFRNVDVLLIDDIQFLAGKERTQEEFFHTFN
FT                   ALHETMKQIVIASDRPPKELADFEDRLRSRFEWGLIADIQPPDLETKVAILQRKAEAES
FT                   TTLPTDVALFIASNVRTNVRELEGALIRVIAWCSHHGVECSLPVAQQCLKQFIDTQVRK
FT                   ITIEAIQRAVAEQFGMRVPELKQKNNSRQIVVPRQIAMYLAKQMTEASLPEIGRQFGGK
FT                   HHTTVMHSIAKIDEQRRADKDLNRTINKLMETLS"
FT                   /protein_id="YP_004215872.1"
     ATGTCATTTG TTCCTACGGC CACAGCCGTG CTGAATCACT GGGTCCGCAT CCTCGGTGCG        60
     CTCGAAAAGA AGATCAACCG TCAGTCCTTC GAGACGTGGT TGAAGCCAAC GCGCTACTCG       120
     CGCACGGTGG GCAAGACGCT GTTCGTCCGG ATTCCTTCGG CGCAGTTCGA ACACATTGGC       180
     GACAAGTATG GGGATCTGAT TGAAGAGGCT ATCGAGAAGC TGGGCTTCGA GATCGAGTCG       240
     GTGACGTTTG AGACGCCGCA GCAAGATCCG ACGGCTCCGC GGGTGCGGGA GGACGGCGGG       300
     TTCGGGCCAA TGCCGAGCCA TGCGACGAAT ACGCCGGGCG GTACGAATGG GAACGGGGCT       360
     GGGAACGGCG CGACCTCCGG GGCGATTCGG CAGAATGGTG CGCGTGGGAA TGCCGCGCCG       420
     GCTGCGCCTT CGACCGAGCA GGCGAGGTTC GATTGGAATG CTGCTTCGCA GTTGAATCCG       480
     CGGTATCAGT TCGACGCGTT TGTGATTGGG AGTGGGAACC AGTTTGCCGC GGCTGCTGCG       540
     CAGGCTGTCG CGGAGAGGCC TTCCAAGGCT TACAACCCGC TGTTTCTGTA TGGCGGCGTA       600
     GGGATGGGCA AGACGCACCT GATGCATGCG ATCGGGCATG AGGTGAAGCG GCGGATGCCG       660
     CATACCTCGA TCAGCTATGT GAGCGGTGAG AAGTTTACGA ACGAGATGAT CAACTCGGTT       720
     CGGTACGACA AGATGACCAC ATTCCGGGAC AAGTTCCGGA ATGTGGACGT GTTGCTGATC       780
     GACGATATTC AGTTCCTGGC GGGCAAGGAA CGGACGCAGG AAGAGTTCTT CCATACGTTC       840
     AACGCGCTGC ACGAGACGAT GAAGCAGATT GTGATTGCGA GTGACCGGCC TCCGAAGGAG       900
     TTGGCGGACT TTGAGGATCG CCTGCGGAGC CGCTTTGAGT GGGGCCTGAT CGCAGATATT       960
     CAACCACCGG ATCTGGAGAC GAAGGTTGCA ATCCTGCAGC GGAAGGCCGA GGCTGAGAGC      1020
     ACGACGCTGC CTACGGATGT GGCGCTGTTT ATTGCTTCCA ACGTGCGGAC GAATGTGCGT      1080
     GAGCTCGAGG GTGCGTTGAT CCGGGTGATT GCCTGGTGCT CGCATCATGG CGTTGAGTGC      1140
     TCATTGCCTG TGGCGCAGCA GTGTTTGAAG CAGTTCATCG ACACGCAGGT ACGCAAGATT      1200
     ACGATCGAGG CGATTCAGCG TGCGGTGGCC GAGCAGTTCG GGATGCGGGT GCCGGAGTTG      1260
     AAGCAGAAGA ACAACTCGAG GCAGATCGTG GTGCCGCGGC AGATTGCGAT GTACCTGGCG      1320
     AAGCAGATGA CGGAGGCTTC GCTGCCGGAG ATCGGACGGC AGTTTGGGGG CAAACACCAT      1380
     ACGACGGTGA TGCACTCGAT TGCGAAGATC GACGAGCAGC GGCGGGCGGA TAAGGATCTG      1440
     AACCGGACGA TCAATAAGCT GATGGAGACG TTGAGTTAA                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page