(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE11

ACIDO1_5.PE11        Location/Qualifiers
FT   CDS_pept        10832..13429
FT                   /locus_tag="AciX9_0011"
FT                   /gene_family="HOG000100642" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /codon_start="1"
FT                   /product="TonB-dependent receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; Cna B domain protein; KEGG: sus:Acid_3639
FT                   TonB-dependent receptor"
FT                   /db_xref="GI:322433670"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="GeneID:10201984"
FT                   /translation="MDDKGGLLPKASLTVKNDAGGAAQTAITDAAGRFTLSGLVAGSYT
FT                   VQATAPGFNTITKNVRVTDGGTNEVSLSLSIGNLTDQVTVEANSQGSVAAALAPMDALL
FT                   EATSARTEITSAFIQNFTSPVADFGEAVEMAPGTFTTNGNGVGLGQSSTYFRGFPDGDY
FT                   DIDFDGIPFYDTNTPSHHSWAFFPSQFLGGIDFDRSPGTASTIGPTPFGGSIHLLSKQF
FT                   SPMQNVRGGFSYGSFNTKLFDGEYDSGNFGPAHKFNVNVDVHHLGSDGYQTFNHQTRNA
FT                   GDIQFQYRPSDKTTITGFSAVIWLDANTPNFAATRCQMYGAQAGYTCTGANAPFAGSGI
FT                   NFLLTNNSDPLLYLNNQYNYYHVPTDFEYVGVRSELGKGFTFSIKPYTYNYDNSEKYSN
FT                   AVPITDNAALVGTTYAPLNVKIANTCSTLVKSKYTCGVDKYNSYRKYGETSELTQVSHF
FT                   GIFRAGLWYEWANTNRHQYPADPLQNWLDAPLPNFAETFVTNSYQPFVEYQYHATPKLT
FT                   ITPGIKFAYYTIGTKQFADNGGKIGGLGSNNPAAFITNGGSYFSSLPSGDVNYRIRDNW
FT                   SMYGQVATGSIVPASGTFDFTQSATGTPVATLPKQQKNLTYQTGTVLKLKRVTFDFDYF
FT                   HIHFDSGYSSFTPIDTGEPVYYLQPPSVTQGIEGESNVYITHGLSLYLNASYNRAQYTG
FT                   NATVFCNTAAACLSSTPQLSIATPGGQRISNAPSDIETEGLTYQHRSWDAGAFNKRVGT
FT                   MSLDNSGFHNAGTIDPFTLTNVFLNYTIKSGTHFNQTKIRLSFNNIFDNHNITGDSFAT
FT                   KATPLLITANGNTYNNPFVSASPITPLSGADAVSILPGRSVMLSVTFGLSPKR"
FT                   /protein_id="YP_004215882.1"
     ATGGATGACA AGGGTGGACT CCTGCCTAAG GCCAGCCTGA CCGTGAAGAA CGATGCGGGT        60
     GGCGCGGCTC AGACTGCGAT CACCGATGCG GCGGGGCGCT TTACGTTGAG CGGGCTGGTG       120
     GCTGGATCGT ATACGGTTCA GGCGACTGCG CCAGGCTTCA ACACGATCAC GAAGAACGTG       180
     CGCGTGACGG ACGGTGGTAC GAACGAGGTT TCGCTGTCGC TGTCGATCGG CAACCTGACG       240
     GATCAGGTGA CGGTGGAGGC GAACTCGCAA GGCTCCGTGG CGGCTGCGCT TGCGCCGATG       300
     GATGCACTGC TGGAGGCGAC GTCGGCGCGG ACCGAGATTA CGTCTGCGTT CATTCAGAAC       360
     TTCACCTCGC CGGTGGCGGA CTTTGGCGAG GCTGTTGAGA TGGCTCCCGG GACGTTTACG       420
     ACGAACGGGA ATGGCGTGGG GTTGGGGCAG TCTAGTACAT ACTTCCGTGG GTTCCCGGAT       480
     GGCGACTACG ATATCGACTT CGATGGGATT CCGTTCTACG ACACGAATAC GCCTTCGCAT       540
     CACTCGTGGG CTTTCTTTCC TTCACAGTTT CTGGGTGGGA TTGACTTTGA CCGCTCGCCG       600
     GGCACGGCGA GCACGATTGG ACCTACGCCT TTTGGCGGAT CGATCCACCT GCTGTCCAAG       660
     CAGTTTTCTC CGATGCAGAA TGTGCGTGGC GGATTCTCGT ATGGCTCGTT CAATACGAAG       720
     CTGTTCGATG GCGAGTATGA CTCGGGTAAC TTTGGGCCGG CCCATAAGTT CAATGTGAAT       780
     GTGGATGTTC ATCATCTTGG CTCGGACGGG TACCAGACGT TCAACCATCA GACTCGCAAT       840
     GCGGGGGATA TCCAGTTCCA ATACCGGCCT TCGGATAAGA CGACGATCAC TGGATTTTCC       900
     GCGGTGATCT GGCTGGATGC GAATACACCG AACTTTGCGG CGACTCGCTG CCAGATGTAT       960
     GGGGCGCAGG CAGGGTATAC ATGCACGGGG GCGAATGCTC CGTTTGCGGG ATCCGGAATC      1020
     AACTTCCTGC TGACCAATAA CTCTGATCCG TTGCTTTATC TGAACAATCA GTACAACTAC      1080
     TACCATGTGC CTACGGACTT TGAGTATGTG GGTGTGCGGA GCGAGCTTGG CAAGGGCTTC      1140
     ACGTTTTCAA TCAAGCCTTA CACGTATAAC TACGACAACT CTGAGAAGTA CTCGAATGCT      1200
     GTGCCGATCA CAGATAACGC AGCGCTGGTG GGAACGACGT ATGCGCCTCT GAACGTGAAG      1260
     ATTGCGAATA CCTGCAGCAC GCTGGTGAAG AGCAAGTACA CGTGCGGCGT GGATAAGTAC      1320
     AACAGCTATC GCAAGTATGG CGAGACGTCC GAGCTGACGC AGGTGTCGCA CTTCGGCATC      1380
     TTCCGCGCAG GGCTCTGGTA TGAGTGGGCG AATACGAATC GGCACCAGTA TCCTGCTGAT      1440
     CCGCTGCAGA ACTGGCTGGA TGCGCCGCTG CCGAACTTTG CCGAGACCTT TGTTACGAAT      1500
     TCGTATCAGC CGTTTGTGGA GTACCAGTAC CACGCGACGC CGAAGCTGAC GATTACGCCG      1560
     GGTATCAAGT TTGCGTATTA CACGATCGGG ACGAAGCAGT TTGCGGATAA CGGCGGGAAG      1620
     ATCGGCGGCC TAGGAAGCAA CAATCCGGCA GCGTTCATCA CGAACGGCGG CAGCTACTTT      1680
     TCATCGCTGC CTTCGGGTGA TGTGAACTAT CGGATACGCG ACAACTGGAG CATGTATGGG      1740
     CAGGTGGCTA CGGGCAGCAT CGTGCCTGCT TCCGGGACGT TTGACTTTAC GCAGTCAGCC      1800
     ACCGGCACGC CGGTTGCAAC GCTGCCGAAG CAGCAGAAGA ACCTGACCTA TCAGACGGGG      1860
     ACGGTGCTGA AGCTCAAGCG CGTGACGTTC GACTTCGACT ACTTCCACAT TCACTTCGAT      1920
     AGCGGCTACT CTTCGTTTAC GCCGATCGAT ACGGGCGAGC CGGTGTACTA CCTGCAGCCG      1980
     CCTTCAGTGA CGCAGGGTAT CGAAGGGGAG AGCAACGTTT ACATCACGCA TGGGCTGAGC      2040
     CTGTACCTGA ACGCGAGCTA CAATCGCGCA CAGTACACGG GCAATGCGAC TGTGTTCTGC      2100
     AATACGGCCG CAGCTTGTCT GTCCAGCACA CCGCAGCTTT CGATTGCGAC TCCTGGCGGC      2160
     CAACGGATCT CGAATGCGCC TTCGGATATC GAGACGGAAG GTCTGACGTA TCAGCACAGG      2220
     TCATGGGACG CTGGCGCCTT CAATAAGCGC GTGGGAACGA TGAGCCTGGA TAACAGCGGG      2280
     TTTCACAATG CGGGGACGAT CGATCCGTTC ACGCTGACGA ACGTGTTCCT GAACTACACG      2340
     ATCAAGAGTG GAACACACTT CAACCAGACG AAGATTCGCC TGAGCTTTAA TAACATCTTC      2400
     GACAACCACA ACATCACGGG CGACAGCTTT GCGACGAAGG CGACGCCGCT GCTGATCACC      2460
     GCCAATGGGA ATACCTACAA CAACCCCTTT GTCTCAGCTT CACCGATCAC GCCGCTGTCC      2520
     GGGGCGGATG CGGTGTCGAT CCTTCCGGGA CGGAGCGTGA TGTTGTCGGT GACGTTCGGG      2580
     CTTTCTCCGA AGCGGTAA                                                    2598
//

If you have problems or comments...

PBIL Back to PBIL home page