(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE13

ACIDO1_5.PE13        Location/Qualifiers
FT   CDS_pept        complement(14972..17518)
FT                   /locus_tag="AciX9_0013"
FT                   /gene_family="HOG000135096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01713"
FT                   /codon_start="1"
FT                   /product="Smr protein/MutS2"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2271 MutS2 family protein; PFAM: Smr
FT                   protein/MutS2; DNA mismatch repair protein MutS domain
FT                   protein; SMART: DNA mismatch repair protein MutS domain
FT                   protein; MutS III domain protein; Smr protein/MutS2"
FT                   /db_xref="GI:322433672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="GeneID:10201986"
FT                   /translation="MTQLLPQIPSPLLESSSLALEWPRLRALIAAKAISPLGRAWTLAL
FT                   EPSTDLTWIIAQQTRTSELRSFLTGGGSFDFHGLFDPEALLAKARIDGTALESLEILTL
FT                   LNLTERVAAWRSLLAAAESARRLGPSIRALSEPLSYHDLAPLLRTLRGKIEPDGSLSDD
FT                   ASPELKRIRRAMESQHRAIEASLRRAARALREEGSTQSDRDDLITVRGERFVIPIKAEF
FT                   KRKVPGVIHGSSSSGQTVYVEPLETIEQNNELVRLLDEEQSEIHRILVALTRALAAQAH
FT                   VLSIGTIILAEVESHFIRARFAQDLDCTAPTFTPGLSLKSARHPLLELRMRAENLGAPG
FT                   PDSRTWVGTTDTPERKPTKPIPLTLALTTEARQLIISGPNTGGKTVSLKTTGLLALMAQ
FT                   AGLLVPAEEATFPLFTAIFADIGDAQSIERNLSSFSAHVVNVDHISRHADGHSLVLLDE
FT                   LGSATDPEEGAALAVAVAEHFLNLNAWTAITTHLTSLKVYAAQHTGVLNAAVGFDQATL
FT                   TPTYELRLGVPGASAGLNIAARLGMAPTIIASARAQMTTQQADIGAFLDQLHDQISAAT
FT                   SERVSLKRRTEEVATERARLETEGRAEQKQRTRELELKLKTLLEDFETQLKETVNEIED
FT                   KTVARKIQRDSALRMARVRREFSDQFSSTVLAHTAGADKNDIASPLARRALTPIKAGDY
FT                   VTLKSLRRQATVVRVIDEHNFEVSMGQMKMRVPRTDIADVEVIKVVTPAEAARRRGNIT
FT                   VQTASGAPLGDSDYTPREINVIGRTAAEAEDEVSRYIDKAFLSGLERVRIVHGTGMGVL
FT                   RRTLREFLKSHPHVATFAEASQQEGGQGATLVDLRQ"
FT                   /protein_id="YP_004215884.1"
     gtgacccagc ttctccccca gatcccgtcc ccgcttcttg aatccagctc cctcgcactc        60
     gagtggccgc gcctccgcgc ccttatcgcc gccaaagcca tcagccccct cggccgcgcc       120
     tggaccctcg cactcgagcc ctccaccgat ctcacctgga ttatcgcgca gcaaacccgc       180
     acctcagagc tccgttcctt cctgaccggc ggcggatcgt tcgacttcca cggcctcttc       240
     gaccccgaag ccctcctcgc caaggcccga atcgacggca ccgccctcga gtccctcgag       300
     atcctcaccc tcctcaacct caccgagcgc gtcgccgcct ggcgctccct cctcgccgca       360
     gccgagtccg cccgccgcct cggcccctcc atccgcgccc tctccgagcc cctcagctac       420
     cacgacctcg ccccgctcct ccgcaccctc cgcggcaaga tcgagcccga cggcagcctc       480
     tcagacgacg ccagcccgga gctcaaacgc atccgccgcg ccatggagtc gcagcaccgg       540
     gccatcgaag ccagcctccg ccgcgccgcc cgagccctcc gcgaagaggg aagcacccag       600
     tccgaccgcg acgacctcat caccgtccgc ggcgagcgct tcgtcatccc catcaaagcc       660
     gagttcaaac gcaaggtccc cggcgtcatc cacggcagca gctcttccgg ccagaccgtc       720
     tacgtcgagc cgctggaaac catcgagcaa aacaacgaac tagtccgcct cctcgacgaa       780
     gaacaatccg aaatccaccg catcctcgta gccctgacaa gagccctggc agcacaagcc       840
     cacgtcttaa gtatcggcac catcatcctg gcagaggtcg aatcccactt catccgcgcc       900
     cgcttcgccc aggacctcga ctgcaccgcc cccaccttca cccccggcct gagcttgaaa       960
     tccgcccgcc accccttact agaactccgc atgagagccg aaaatctggg tgccccaggt      1020
     ccggactctc ggacctgggt tgggaccacc gacacccccg aaagaaaacc cacaaaacca      1080
     atcccactaa ccctggccct cacgacagaa gcccgccaac tcatcatctc cggccccaac      1140
     acgggcggca aaaccgtttc cctgaaaacc accggccttc tcgccctcat ggcccaggca      1200
     ggcctcctgg tccccgccga agaagccacc ttccccctct tcaccgccat cttcgccgac      1260
     atcggcgacg cccaatccat cgagcgcaat ctctccagct tctccgccca cgtcgtcaac      1320
     gtggaccaca tctcccgcca cgccgacggc cactccctcg tcctcctcga cgagctaggc      1380
     tccgccaccg atcccgaaga aggcgcagcc ctcgccgtcg ccgtagccga gcacttcctc      1440
     aacctcaacg cctggaccgc catcaccacc cacctcacct ccctcaaggt ctacgccgcc      1500
     cagcacaccg gcgtcctcaa cgccgccgta ggcttcgacc aggccaccct cacccccacc      1560
     tacgagctcc gcctcggagt ccccggtgcc tccgccggtt tgaacatcgc agcccgcctc      1620
     ggcatggccc ccaccatcat tgccagcgcc cgcgcccaga tgaccaccca gcaggccgac      1680
     atcggtgcct tcctcgatca actccacgac cagatctccg ccgcaacctc ggagcgcgtc      1740
     tccctgaaac gccgcacaga ggaagtagcc acggaaagag cccgcctcga aaccgaaggc      1800
     cgcgccgaac aaaaacagcg cacaagagag ctcgaactaa aactcaaaac cctcctcgaa      1860
     gacttcgaga cccaactcaa ggaaaccgtc aacgagatcg aagacaagac ggtcgcccgc      1920
     aaaatccaac gcgattcagc cttacgcatg gcccgcgtcc gcagagaatt ctcagaccag      1980
     ttcagctcta ccgtcctggc ccacaccgcc ggagccgaca agaacgacat cgcctccccc      2040
     ctcgcccgcc gagccctcac ccccatcaag gccggcgact acgtcaccct caaatccctc      2100
     cgccgccagg ccaccgtcgt ccgcgtcatc gacgagcaca actttgaagt ctccatgggc      2160
     cagatgaaga tgcgcgtccc ccgcaccgac atcgccgacg tagaagtcat caaggtcgtc      2220
     acccccgccg aagccgcacg ccgtcgcggc aacatcaccg tccagaccgc cagcggcgcg      2280
     cccctcggcg actccgacta cacccccaga gagatcaacg tcataggccg gactgctgcc      2340
     gaggcggagg atgaagtctc ccgctacatc gacaaagcct tcctctccgg cctggagcgc      2400
     gtccgcatcg tccacggcac aggcatgggc gtcctaagac gcaccctccg cgagttcctc      2460
     aaatcccatc cccacgtcgc caccttcgcc gaagccagcc agcaggaggg cggccaggga      2520
     gccaccctcg tagacctgcg gcaatag                                          2547
//

If you have problems or comments...

PBIL Back to PBIL home page