(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE14

ACIDO1_5.PE14        Location/Qualifiers
FT   CDS_pept        17585..19639
FT                   /locus_tag="AciX9_0014"
FT                   /gene_family="HOG000245572" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.4.24.71"
FT                   /codon_start="1"
FT                   /EC_number="3.4.24.71"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_1491 PgPepO oligopeptidase; PFAM:
FT                   peptidase M13; Peptidase M13, neprilysin-like"
FT                   /db_xref="GI:322433673"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="GeneID:10201987"
FT                   /translation="MKLKMAAAVLSLLGGVGAGAQGTVLPVVQPLSAIPFSPVLDLTSL
FT                   DKTVDPCVDFYKFSCGGWMKKNPIPADQASWSVYHKLAIDNQQFLWGILKDDAVAKDRT
FT                   PVQQKVGDYYAACMNTPAIDALGMKPVEAGLARLDMITTREQAAHAIATLHHNVAGSFF
FT                   FGSGVGQDAVDSSTEIVEVGAGGLGLPDRDYYLKTDAKSVKLREQYVAYVQQLMTLAGE
FT                   PSEKASADAKAILTIETALATGSLTVVERRDPHKIYHMMTLAELGGLAPGIDWAGYFKT
FT                   QGAGAFTKLNVSQPEFMKAVQAELMTEPVEALKAYLKFHMLTAAAPYLSHPFVQANFDF
FT                   YSKTLRGVPTMPARWKTCTGGVDRMLGEALGQEFVRRTFSSEMKAKTRTMTEQIEAAMK
FT                   GEIEGLDWMSPETKVEAERKLHAIRNKIGYPDTWRDYSTLEVKPDDYAGDAVRAYRFED
FT                   ARNWNKLGKPVDLTEWGMTPPTVNAYFNPQMNDINFPAGVLQPPLYDAKEDDAPNYGNT
FT                   GATIGHELTHAFDDEGRQFDDKGNLRDWWTAADAKGFEQRIQCVRDQYAGYVVVDDIHI
FT                   NSKLTSGEDVADLGGTLLAYIAWKKETAGQKLMPINGFTPDQRFFVGMAQWACENERPE
FT                   NLRVSAATDPHSPGFARINGVVSNMPEFKNAFQCKAGQAMVHVPACRVW"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /protein_id="YP_004215885.1"
     ATGAAATTGA AGATGGCTGC GGCGGTTCTG AGTTTGCTGG GTGGTGTGGG CGCGGGTGCG        60
     CAGGGTACGG TACTGCCGGT GGTGCAGCCT CTGAGTGCGA TTCCGTTTTC ACCGGTGCTG       120
     GATCTGACGA GCCTGGATAA GACCGTGGAC CCTTGCGTGG ATTTTTATAA GTTCTCCTGC       180
     GGCGGGTGGA TGAAGAAGAA TCCGATTCCG GCGGACCAGG CGAGCTGGAG CGTTTATCAC       240
     AAGCTGGCGA TCGACAATCA GCAGTTCCTG TGGGGGATTC TGAAGGATGA CGCGGTGGCG       300
     AAGGATCGGA CGCCGGTGCA GCAGAAGGTG GGAGATTACT ATGCGGCGTG TATGAATACG       360
     CCGGCGATCG ACGCGCTGGG GATGAAGCCG GTGGAGGCTG GGCTGGCTCG GCTGGACATG       420
     ATCACGACCC GGGAGCAGGC GGCTCATGCG ATTGCGACGC TGCACCACAA TGTTGCGGGG       480
     AGCTTCTTCT TCGGGTCCGG CGTGGGGCAG GATGCGGTGG ATTCCTCGAC CGAGATTGTG       540
     GAGGTTGGCG CGGGCGGGCT GGGGCTGCCG GACCGGGACT ACTACCTGAA GACGGATGCG       600
     AAGAGCGTGA AGCTGCGGGA GCAGTACGTG GCTTACGTGC AGCAGTTGAT GACGCTGGCG       660
     GGTGAGCCGA GCGAGAAGGC CAGCGCGGAT GCGAAGGCGA TTTTGACGAT CGAGACGGCG       720
     CTGGCGACGG GGTCGCTGAC GGTGGTGGAA CGGCGCGATC CGCACAAGAT CTATCACATG       780
     ATGACGCTGG CGGAGCTGGG CGGGCTTGCG CCGGGGATCG ACTGGGCGGG GTACTTCAAG       840
     ACGCAGGGAG CGGGCGCGTT TACGAAGCTG AATGTATCGC AGCCGGAGTT CATGAAGGCG       900
     GTGCAGGCGG AGCTCATGAC GGAGCCGGTG GAGGCGCTGA AGGCCTATCT GAAGTTCCAT       960
     ATGCTGACGG CTGCCGCGCC TTATCTTTCG CATCCGTTTG TGCAGGCAAA CTTTGATTTC      1020
     TACTCGAAGA CGCTGCGCGG CGTGCCGACG ATGCCGGCGC GCTGGAAGAC CTGCACGGGT      1080
     GGCGTGGACC GGATGCTCGG CGAGGCGCTG GGGCAGGAGT TTGTGCGGCG GACGTTTTCG      1140
     AGCGAGATGA AGGCCAAGAC GCGGACGATG ACGGAGCAGA TTGAGGCTGC GATGAAGGGG      1200
     GAGATCGAAG GGCTGGACTG GATGAGCCCG GAGACGAAGG TGGAGGCGGA GAGAAAACTT      1260
     CATGCGATCC GGAACAAGAT CGGGTATCCG GATACGTGGC GGGACTACTC GACGCTGGAG      1320
     GTCAAGCCGG ATGATTATGC GGGTGACGCG GTGCGTGCGT ACCGGTTTGA GGATGCACGG      1380
     AACTGGAACA AGCTGGGCAA GCCGGTGGAC CTGACGGAGT GGGGGATGAC GCCGCCGACG      1440
     GTGAACGCGT ACTTCAATCC GCAGATGAAC GACATCAACT TCCCGGCGGG CGTGCTGCAG      1500
     CCGCCGCTCT ACGATGCGAA GGAAGACGAC GCGCCGAACT ACGGGAACAC GGGCGCGACG      1560
     ATTGGGCATG AGCTGACGCA TGCGTTCGAC GACGAGGGCC GGCAGTTCGA CGATAAGGGC      1620
     AACCTGCGGG ACTGGTGGAC GGCGGCGGAT GCGAAGGGGT TCGAGCAGAG GATCCAGTGC      1680
     GTGCGCGACC AGTATGCGGG GTATGTGGTG GTCGACGACA TCCATATCAA CTCCAAGCTG      1740
     ACGAGCGGGG AGGATGTGGC GGATCTGGGT GGGACTTTGC TCGCGTACAT TGCGTGGAAG      1800
     AAGGAGACTG CGGGACAGAA GCTGATGCCG ATCAATGGAT TTACGCCGGA TCAGCGGTTC      1860
     TTCGTCGGGA TGGCGCAGTG GGCTTGCGAG AACGAACGGC CGGAGAACCT GCGGGTGAGC      1920
     GCGGCGACCG ATCCGCACTC GCCTGGGTTC GCGCGGATCA ATGGGGTTGT GTCGAATATG      1980
     CCGGAGTTCA AGAATGCGTT TCAGTGCAAG GCGGGGCAGG CCATGGTGCA TGTGCCGGCT      2040
     TGCCGGGTTT GGTAA                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page