(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE15

ACIDO1_5.PE15        Location/Qualifiers
FT   CDS_pept        20202..20543
FT                   /locus_tag="AciX9_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_7413"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_7413 hypothetical protein"
FT                   /db_xref="GI:322433674"
FT                   /db_xref="GeneID:10201988"
FT                   /translation="MVAGIAAYFAVHALARHGWWGDGSDFMPEVFQCLLPFIAFGTTVM
FT                   AGLSVLTGYGLLTRRSWGRPLAIIMAILSLIKIPLGTALGIYTLWVLGSKAGGAEYEGL
FT                   AAAEEGIRV"
FT                   /protein_id="YP_004215886.1"
     ATGGTGGCGG GGATCGCCGC TTACTTTGCC GTGCATGCGC TGGCGCGCCA CGGCTGGTGG        60
     GGCGATGGGT CGGATTTTAT GCCGGAGGTG TTTCAGTGCC TGCTGCCGTT CATCGCATTC       120
     GGGACAACCG TCATGGCGGG GTTATCCGTG TTGACAGGCT ATGGACTGCT GACGCGGCGT       180
     AGCTGGGGCC GGCCGCTGGC GATCATCATG GCGATACTTT CGCTGATCAA GATCCCGCTG       240
     GGCACGGCGC TGGGAATCTA TACGCTTTGG GTGCTGGGAT CGAAGGCGGG TGGTGCGGAG       300
     TATGAAGGTC TGGCGGCTGC GGAAGAGGGG ATACGGGTCT AG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page