(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE16

ACIDO1_5.PE16        Location/Qualifiers
FT   CDS_pept        complement(20660..21346)
FT                   /locus_tag="AciX9_0016"
FT                   /gene_family="HOG000275099" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_1798"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_1798 hypothetical protein"
FT                   /db_xref="GI:322433675"
FT                   /db_xref="GeneID:10201989"
FT                   /translation="MKVMLFGGTGMVGQGALRECLLDPSIKEVVAITRSTVAQPIPTPS
FT                   PKLRQIIRKDLFDLDGLDDEFAAVDTCMFCLGVTSFRMKEDDYRHITYDLTLSVAKRFV
FT                   RVNPKVVFIYVSGAGTDSTGESKTMWARVKGETENDLLALPLRAAFMFRPGGIVPQHGI
FT                   KSKTAVYQVFYSILKPIMPLFERFFPKYVTTTDQLGGAMLRLAKKGVAQEGPPRRVLES
FT                   VDIARM"
FT                   /protein_id="YP_004215887.1"
     atgaaggtaa tgctgttcgg gggaacgggt atggtcggcc agggcgcgct gcgcgagtgc        60
     ctcctcgatc cctccatcaa ggaagtcgtc gccatcaccc gcagcaccgt cgcccagccc       120
     atccccaccc cctcgcccaa actgcgccag atcattcgca aggacctctt cgacctggac       180
     ggcctcgacg atgagttcgc cgccgtcgat acctgcatgt tctgtctcgg cgtcacctcc       240
     ttccggatga aggaggacga ctaccgccac atcacctacg acctcaccct ctcggtcgcc       300
     aagcgcttcg tccgcgtcaa ccccaaggtc gtcttcatct acgtctccgg agccggcacc       360
     gactccaccg gcgagagcaa gaccatgtgg gcccgcgtca aaggcgagac cgaaaacgac       420
     cttctcgccc tgcccctgcg cgccgccttc atgttccgcc ccggcggcat cgtcccccag       480
     cacggcatca agtccaagac cgccgtctac caggtcttct actccatcct caagcccatc       540
     atgccgctct tcgagcgctt cttccccaag tacgtcacca ccaccgacca gctcggcggt       600
     gccatgctgc gcctcgccaa aaagggcgtg gcccaggaag gcccgccccg ccgcgtactg       660
     gaaagtgtcg atatcgcccg catgtaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page