(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE17

ACIDO1_5.PE17        Location/Qualifiers
FT   CDS_pept        21464..22453
FT                   /locus_tag="AciX9_0017"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.24"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: aca:ACP_2188
FT                   delta-aminolevulinic acid dehydratase; PFAM:
FT                   delta-aminolevulinic acid dehydratase"
FT                   /db_xref="GI:322433676"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="GeneID:10201990"
FT                   /translation="MTGHVTRMRRMRRTEALRSLVRETHLRPESLIYPLFIVPGEGVRK
FT                   PISSMPGVFNVSVDEALKDAAECVELGLGGLLLFGLPPEKDEQGSGAWDEQGIMQTALR
FT                   AIKRESGLKSLVTIADVCLCEYTSHGHCGIVARDGEEYAVENDSSVRLIAKTAASLAEA
FT                   GADIVAPSDMMDGRVEAIRAALDEGGHQQTPIMSYAAKFASAFYGPFREAADSAPQFGD
FT                   RKTYQMDGANRREAMREIEQDLLEGADMILMKPAMPYLDVLKEARDRYEVPIGAYQVSG
FT                   EYSMLVAAFERGWLERERAIIESLLSLRRAGADFIVTYFAKEAGRALG"
FT                   /product="Porphobilinogen synthase"
FT                   /protein_id="YP_004215888.1"
     ATGACAGGAC ACGTTACGCG GATGCGAAGG ATGCGCCGGA CGGAGGCTCT GCGGAGCCTG        60
     GTGCGGGAGA CGCATCTGCG CCCGGAAAGC TTGATTTACC CGCTGTTCAT TGTGCCGGGT       120
     GAGGGTGTGC GGAAGCCGAT CTCGTCCATG CCGGGGGTGT TCAATGTCTC GGTGGATGAG       180
     GCGCTGAAGG ATGCGGCGGA GTGCGTGGAA CTGGGGTTGG GTGGCTTGCT GCTGTTCGGA       240
     CTGCCGCCGG AGAAGGATGA GCAGGGCAGC GGGGCGTGGG ACGAGCAGGG CATCATGCAG       300
     ACGGCGCTGC GGGCGATCAA GCGGGAAAGC GGGCTGAAGA GCCTGGTGAC GATCGCCGAT       360
     GTGTGTCTGT GCGAGTACAC GTCGCATGGG CATTGCGGGA TCGTGGCTCG GGACGGCGAG       420
     GAGTATGCGG TGGAGAACGA CTCCAGCGTG CGGCTGATTG CGAAGACGGC TGCGTCGCTG       480
     GCGGAGGCGG GTGCGGATAT CGTCGCGCCC AGCGACATGA TGGACGGACG GGTGGAGGCG       540
     ATCCGCGCGG CGCTGGACGA GGGAGGGCAC CAACAGACTC CGATCATGAG CTATGCGGCG       600
     AAGTTTGCGA GTGCGTTCTA CGGGCCGTTC CGCGAGGCGG CCGATTCCGC GCCTCAGTTT       660
     GGGGATCGGA AGACGTACCA GATGGACGGG GCGAACCGGC GGGAGGCGAT GCGGGAGATC       720
     GAGCAGGACC TGCTGGAGGG TGCGGATATG ATCCTGATGA AACCCGCGAT GCCATATCTG       780
     GATGTGCTGA AAGAAGCACG GGACCGGTAC GAAGTCCCAA TTGGGGCATA TCAGGTTTCA       840
     GGGGAATACA GTATGCTGGT CGCTGCATTC GAACGTGGAT GGCTCGAGCG AGAACGTGCG       900
     ATTATCGAGT CTCTCCTTTC ACTGCGACGG GCCGGGGCTG ATTTCATCGT GACCTACTTC       960
     GCGAAAGAAG CGGGGCGGGC ACTGGGGTAA                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page