(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE18

ACIDO1_5.PE18        Location/Qualifiers
FT   CDS_pept        22559..22900
FT                   /locus_tag="AciX9_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BMD_0418"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmd:BMD_0418 hypothetical protein"
FT                   /db_xref="GI:322433677"
FT                   /db_xref="GeneID:10201991"
FT                   /translation="MRRNLALILLFGWVPVALGVFLLSEFWLQQPFLTLGVIIGWFVAA
FT                   CGMIWWAGEFRCPRCRRRYGAVGSRKGVNLIWRGLFDSICNNCKLRKFENFNSEGSNPG
FT                   SLDRRMARD"
FT                   /protein_id="YP_004215889.1"
     ATGCGGCGGA ATCTTGCACT CATTCTGCTT TTTGGCTGGG TTCCGGTGGC TCTAGGAGTG        60
     TTTCTGCTCT CAGAGTTTTG GCTGCAACAG CCCTTCCTGA CCCTTGGGGT CATCATCGGG       120
     TGGTTTGTTG CGGCGTGCGG GATGATCTGG TGGGCGGGAG AGTTCCGCTG TCCGCGCTGC       180
     CGTCGCCGAT ATGGCGCGGT GGGCTCGCGT AAGGGCGTAA ACCTGATCTG GCGGGGACTG       240
     TTCGACTCGA TCTGCAATAA CTGCAAGCTG CGGAAGTTTG AGAACTTCAA CTCTGAGGGG       300
     TCGAACCCTG GAAGCCTGGA CCGGCGGATG GCGCGGGACT AG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page