(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE19

ACIDO1_5.PE19        Location/Qualifiers
FT   CDS_pept        complement(22910..23443)
FT                   /locus_tag="AciX9_0019"
FT                   /gene_family="HOG000116058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF820"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   sus:Acid_5455 hypothetical protein"
FT                   /db_xref="GI:322433678"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="GeneID:10201992"
FT                   /translation="MATPVLIPVEQYLSTSYDPDCDYIDGEVQERNRGERPHSLMQLAL
FT                   SAIFYSNRRAWKVLPMPEQRVQTSATRFRIPDVCLIAASDPADPIVHIPPILCVEIISS
FT                   GQTLRHMQERTDDYLAMGVQQVWVLDPVRREAFIPSPSGVLQPSPDNLNVSGTPIELSW
FT                   TEILREYDDLAAGR"
FT                   /protein_id="YP_004215890.1"
     atggcaacgc ccgtgctcat ccccgtagag cagtacctct ccaccagcta cgacccggac        60
     tgcgactaca tcgacggaga ggttcaggaa agaaataggg gcgagcgtcc gcattctctt       120
     atgcaactgg ctctctcagc catcttctac tccaaccgcc gtgcctggaa ggtccttccc       180
     atgccggagc agcgggtcca gacctccgcc acccgcttcc gcatccccga tgtttgcttg       240
     atcgctgcca gcgacccagc cgaccccatc gtccacatcc cacccatcct ctgcgtcgag       300
     ataatctcct caggacagac cttgcgccac atgcaggagc gcacggacga ttacctcgct       360
     atgggggtcc agcaggtttg ggtccttgac cccgtccgcc gcgaagcttt catcccaagc       420
     ccatctggag tcttgcagcc ctccccagat aacctcaacg tcagcgggac cccaatcgag       480
     ctctcctgga ccgagatcct ccgtgagtac gacgatctcg ccgccggccg ctag             534
//

If you have problems or comments...

PBIL Back to PBIL home page