(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE20

ACIDO1_5.PE20        Location/Qualifiers
FT   CDS_pept        23534..25003
FT                   /locus_tag="AciX9_0020"
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2857 dihydrolipoyl dehydrogenase;
FT                   TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="GI:322433679"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:10201993"
FT                   /translation="MSDTIFDLVVVGGGPAGYTCGIRAAQLGLKVALIEKTDKLGGTCL
FT                   HWGCIPTKSLLFSAEIWDHLKHAANYGIDNVDAPKLNWDNLIKRKSDITNKHTKGLDFL
FT                   MKKNKITVFRGHGRLTGPAKDGIHTITVTDEDKASGRGKDAQAEGYTSQKVDEIKAKKV
FT                   VLSTGSDARMLPGYKADDTILTNMEILTLPAMPKSMVVIGSGAVGVEFASIFKSFGAEV
FT                   TIIEALPRLVNAEDEEISKELLRLYKKRGFEVFLSAKVEKIDKKDGGAVVTFTDSTGKQ
FT                   QTKTAEKVLVAVGRAPRTYDCGLDKVNIPLDRGFIMTNEWMETTEPGIYAIGDIVGGLP
FT                   QLAHVGAMCGVVVASKLAGKYARPVNRQRIPGCTYCDPQIGSVGLTEAQAKEKGYQVKV
FT                   GKFPFVGNSKATILDSHDGFVKVVSDAKYGEVLGVHIIGPQATEIIAECVTALELEATV
FT                   EEMMFTIHAHPTLSESLLDGFSSVEGMAINV"
FT                   /protein_id="YP_004215891.1"
     TTGTCAGATA CGATTTTCGA TTTAGTGGTG GTTGGCGGCG GACCCGCCGG GTATACCTGC        60
     GGCATTCGCG CCGCGCAGCT TGGCCTGAAG GTCGCGCTGA TTGAGAAGAC GGATAAGCTG       120
     GGCGGCACAT GCCTGCACTG GGGCTGCATC CCGACGAAAT CGCTGCTGTT TTCAGCCGAG       180
     ATCTGGGATC ACCTGAAGCA TGCCGCGAAC TACGGCATCG ACAACGTGGA CGCGCCGAAG       240
     CTCAACTGGG ACAACCTGAT CAAGCGTAAG AGCGACATCA CGAACAAGCA CACCAAGGGG       300
     CTTGATTTCC TGATGAAGAA GAACAAGATC ACGGTCTTCC GTGGACACGG CCGCCTGACC       360
     GGACCGGCCA AGGACGGCAT CCACACCATC ACCGTGACGG ACGAAGATAA GGCCTCCGGA       420
     CGCGGCAAGG ATGCGCAGGC TGAGGGCTAT ACCAGCCAGA AGGTTGATGA GATCAAGGCG       480
     AAGAAGGTGG TGCTCAGCAC CGGCTCCGAC GCTCGTATGC TGCCAGGCTA TAAGGCCGAC       540
     GACACGATCC TGACCAACAT GGAGATCCTG ACGCTGCCGG CGATGCCGAA GTCGATGGTG       600
     GTGATCGGGT CCGGAGCTGT GGGGGTTGAG TTCGCTTCGA TCTTCAAGAG CTTTGGCGCG       660
     GAGGTCACGA TCATCGAGGC GCTGCCCCGC CTGGTGAATG CCGAAGACGA GGAGATCTCG       720
     AAGGAGTTGC TGAGGCTCTA CAAGAAGCGC GGCTTTGAGG TCTTCCTCAG CGCGAAGGTG       780
     GAGAAGATCG ACAAGAAGGA CGGCGGTGCG GTGGTCACGT TTACGGACTC GACCGGCAAG       840
     CAGCAGACCA AGACGGCGGA GAAGGTGCTG GTGGCTGTGG GACGCGCGCC GCGCACGTAT       900
     GACTGTGGGC TGGACAAGGT GAACATTCCG CTGGATCGCG GCTTCATCAT GACCAACGAG       960
     TGGATGGAGA CGACGGAGCC GGGGATCTAT GCGATCGGCG ATATCGTGGG CGGGCTGCCG      1020
     CAGTTGGCGC ACGTCGGCGC GATGTGCGGC GTGGTCGTGG CGAGCAAGCT GGCCGGCAAG      1080
     TATGCGCGGC CGGTGAATCG TCAGCGGATT CCGGGCTGCA CGTACTGCGA TCCGCAGATC      1140
     GGCTCGGTTG GGCTGACGGA GGCGCAGGCC AAGGAGAAGG GCTATCAGGT CAAGGTGGGC      1200
     AAGTTCCCGT TCGTGGGGAA CTCCAAGGCG ACGATTCTGG ACTCGCACGA CGGCTTTGTG      1260
     AAGGTGGTGT CCGACGCCAA GTACGGCGAG GTACTGGGAG TCCACATCAT CGGACCGCAG      1320
     GCGACGGAGA TCATCGCGGA GTGCGTCACG GCGCTAGAGC TTGAGGCGAC GGTGGAAGAG      1380
     ATGATGTTCA CGATCCACGC GCATCCGACG CTGAGCGAGA GCCTGCTGGA CGGCTTCTCG      1440
     AGCGTTGAGG GTATGGCGAT CAACGTCTAA                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page