(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE21

ACIDO1_5.PE21        Location/Qualifiers
FT   CDS_pept        complement(25075..25440)
FT                   /locus_tag="AciX9_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cyan7425_3930"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyn:Cyan7425_3930 protein of unknown function
FT                   DUF1400"
FT                   /db_xref="GI:322433680"
FT                   /db_xref="GeneID:10201994"
FT                   /translation="MTIQPPIPPAQTVAIPLTPEVRAAYQALYDANEALIENTTDPGFL
FT                   AALNDVSTNVGNILTKDNLYRIEANNALFQALQQQINSTNASLLALKKQIQAVASHVSE
FT                   AGTVLSAIDKVVSLATG"
FT                   /protein_id="YP_004215892.1"
     ttgaccatcc agccccccat cccacccgcc caaaccgtcg cgatccccct gaccccggag        60
     gtcagggctg cctaccaggc tctctacgat gccaacgagg ctctaatcga aaacaccaca       120
     gaccccggat tccttgcggc gctcaatgac gtcagcacca acgtcgggaa catcctgacc       180
     aaggacaatc tgtatcgcat tgaggccaac aacgccctct tccaagctct tcagcagcag       240
     atcaacagta ccaacgcgag cctgctcgcc ctcaagaagc agatccaggc cgtagcctcg       300
     catgtctctg aagccggcac cgtgctcagc gccatcgaca aggtcgtctc gctcgccaca       360
     ggctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page