(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE22

ACIDO1_5.PE22        Location/Qualifiers
FT   CDS_pept        complement(25493..26533)
FT                   /locus_tag="AciX9_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TGME49_002110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tgo:TGME49_002110 hypothetical protein"
FT                   /db_xref="GI:322433681"
FT                   /db_xref="GeneID:10201995"
FT                   /translation="MQNKLKRRTVEKLGRAASGCVVVLGLGLTLCTTGCLSPLNKHAVA
FT                   LSAATAPVVDGAAVAYNSAESIHDLRENYEAAQQFDAASPVYNPRKIQPLLNDHDIEIR
FT                   LSVLAAFQAYSRSLVEVTNNTDSPELDAASRSAGEGLSALGNSLAPSIENTLGIASTTA
FT                   TQTIVTTTTPGTTSTTSSLSTTPTPAISPAVRTGIETAVNALGQYLVSKKIKSQLPAIV
FT                   KTMDPNVTALCQLLEQDLDTLQSQEQLDFNYIINTQTLFLRSAGMDAQHPAIDPGVRRE
FT                   QIMQLPEIVRQQRSADMQLTALKASVVKLAMTHHALAAAAQDNNPESLKDKLSELEAAG
FT                   SNLGKF"
FT                   /protein_id="YP_004215893.1"
     atgcaaaaca agctgaaacg ccgcactgtg gagaaacttg gccgggctgc gtcaggctgc        60
     gtggtcgtac tggggcttgg cctcaccctc tgcacgaccg gctgcctctc ccctctcaac       120
     aagcatgccg tcgccctctc ggctgccacc gcacccgtcg tggacggcgc ggcggtcgcg       180
     tataactccg cggagagcat ccacgatctg cgcgaaaact atgaagccgc ccagcagttc       240
     gacgcagcct ctcccgtcta caacccacgc aagattcagc cgctcctcaa cgatcacgac       300
     atagagatcc gcttgtccgt cctggcagct tttcaggcct atagccgctc gctcgtcgaa       360
     gtcaccaata acaccgactc gcccgagctt gacgccgcct ccaggtccgc cggcgaaggg       420
     ctcagcgcac tcggcaactc gctcgcaccc tccatcgaga acaccctcgg aatcgcctcc       480
     accaccgcga cccagaccat cgtcaccacc acgacacccg gcaccacgtc gaccacctcc       540
     tccctttcga cgacccctac gccggccatc tctcctgccg tgagaaccgg aatcgaaacc       600
     gcggtcaatg cgctcggcca atatctcgtc agcaagaaga tcaagagcca gctccccgcc       660
     atcgtcaaga cgatggatcc caacgtcacc gcgctctgcc agcttctcga acaggatctt       720
     gacacccttc agagccagga gcagctcgac ttcaactaca tcatcaatac ccagacgctc       780
     ttcctgcgca gcgccgggat ggacgctcaa caccctgcaa tcgatcccgg cgtgcgtcgc       840
     gaacagatca tgcagcttcc ggagatcgtt cgccagcagc gttccgcgga tatgcaactg       900
     accgcgctga aggcctccgt cgtgaagctt gccatgaccc accacgccct tgccgccgct       960
     gcccaggaca acaatcccga gtcgctcaaa gacaagctct ccgagcttga ggcggccggc      1020
     agcaatctcg gaaagtttta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page