(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE23

ACIDO1_5.PE23        Location/Qualifiers
FT   CDS_pept        26645..27403
FT                   /locus_tag="AciX9_0023"
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.181"
FT                   /transl_table="11"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; manually
FT                   curated; KEGG: aca:ACP_2861 lipoate-protein ligase B;
FT                   TIGRFAM: lipoate-protein ligase B"
FT                   /db_xref="GI:322433682"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="GeneID:10201996"
FT                   /translation="MFFHLLSPGRISYAEGLAMQQRVSAARKAGQVGDTLILLEHPPVL
FT                   TLGRNSKRENVLATDALLASKGVELHEVNRGGDVTYHGPGQLVGYPIVDLRGDLPGKKG
FT                   PHLGPVDFVRLLEEVLIRTCGEFRVMTQRVKGRTGVWTLANGSLEERKIAALGVHVSQG
FT                   VTTHGFALNVTTDLRDFEWIVPCGITDRQVTSLELESPLEPVPTLAEALLCTSRNFGKV
FT                   FGRQVLAANSLEALLADGAASHLAETAGVP"
FT                   /product="lipoate-protein ligase B"
FT                   /protein_id="YP_004215894.1"
     ATGTTCTTTC ACCTGCTCTC ACCTGGACGA ATCTCCTATG CGGAAGGGCT GGCCATGCAG        60
     CAGCGGGTCT CCGCGGCGCG CAAGGCGGGT CAGGTGGGCG ATACGCTGAT CCTGCTGGAG       120
     CATCCTCCGG TGCTGACGCT GGGGCGCAAC TCGAAACGGG AGAATGTGCT GGCTACGGAT       180
     GCGCTGCTCG CCAGCAAGGG CGTGGAGCTG CATGAGGTGA ACCGCGGCGG CGATGTGACG       240
     TATCACGGGC CGGGACAGCT GGTGGGGTAT CCCATCGTCG ATCTGCGCGG CGACCTGCCG       300
     GGCAAGAAAG GACCGCACCT GGGGCCGGTG GACTTCGTGC GGCTGCTGGA GGAGGTGCTG       360
     ATCCGCACCT GCGGGGAGTT CCGGGTGATG ACGCAGCGGG TCAAGGGCAG GACGGGTGTC       420
     TGGACGCTGG CCAACGGCAG CCTGGAGGAG CGCAAGATTG CGGCGCTGGG GGTGCATGTC       480
     TCGCAGGGCG TGACCACGCA CGGCTTTGCG CTGAATGTGA CGACGGATCT GCGGGACTTC       540
     GAGTGGATTG TGCCGTGCGG CATTACGGAC CGGCAGGTGA CCAGCCTGGA GCTGGAATCG       600
     CCGCTGGAGC CTGTGCCTAC GCTCGCCGAG GCGCTGCTGT GTACCTCGCG CAACTTCGGC       660
     AAGGTCTTTG GGCGGCAGGT TCTTGCGGCG AACTCGCTTG AGGCGTTGCT GGCGGACGGC       720
     GCGGCATCGC ATCTGGCTGA GACGGCAGGC GTTCCATAA                              759
//

If you have problems or comments...

PBIL Back to PBIL home page