(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE24

ACIDO1_5.PE24        Location/Qualifiers
FT   CDS_pept        27498..29135
FT                   /locus_tag="AciX9_0024"
FT                   /gene_family="HOG000281564" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02927"
FT                   /codon_start="1"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2354 putative dihydrolipoamide
FT                   acetyltransferase; TIGRFAM: 2-oxoglutarate dehydrogenase,
FT                   E2 component, dihydrolipoamide succinyltransferase; PFAM:
FT                   catalytic domain-containing protein of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein"
FT                   /db_xref="GI:322433683"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR014276"
FT                   /db_xref="GeneID:10201997"
FT                   /translation="MPTEVVMPQMGESITEGTLTKWLKKPGDPVERNEPLFEISTDKVD
FT                   AEIPSPAAGIMGEIKTPEGSTVQINTVVCTINEAGSAAAAAPAPADLKADSATPAAEAT
FT                   AAQEAAIPAPEPETEVSGGTEVAMPQMGESITEGTITKWLKNIGDTVARDEPIFEISTD
FT                   KVDAEIPSPVAGTLTEIRVKEGATVTVNTIVAVIGGAAGSKPKAAAPAAVAPAAPAAVA
FT                   AAPTQASQGETPRSSPLVRKIAGDNNIDLQQVSGSGSAGRITKADIMGHLDKPASTAAA
FT                   TPTTVQPSVSAVQSAPATTAPAKAAAPTQQLGELVPMTKMRSIIAKRMVESKQTSPHVH
FT                   TVFKVDMTRIVKLREREKNKYEQRNGTKLTYMPFITRAAVQALKKHPVVNAAIQGDAIF
FT                   YNKNIAIGIAVALEWGLIVPVIKGCEEKNFLGVARSIVDLAERARTKKLAPDEVSGGTF
FT                   TITNAGIFGEQFGTPIINQPQAAILGVGGLNKEALVLTDKDGQDTIAIRNVQRFTLGFD
FT                   HRIVDGADAGKFMSDFKAYLENWAEDIG"
FT                   /protein_id="YP_004215895.1"
     ATGCCGACCG AAGTAGTCAT GCCCCAGATG GGCGAATCCA TTACCGAAGG CACGCTCACG        60
     AAATGGCTCA AGAAGCCGGG CGACCCCGTC GAGCGTAACG AGCCGTTGTT CGAGATCTCG       120
     ACCGACAAGG TTGACGCTGA GATTCCTTCG CCCGCCGCGG GCATCATGGG TGAGATCAAG       180
     ACGCCCGAGG GCTCGACCGT ACAGATCAAC ACGGTTGTCT GCACGATCAA TGAGGCTGGC       240
     TCTGCTGCTG CCGCCGCACC CGCACCGGCT GACTTGAAGG CTGACTCTGC CACTCCCGCT       300
     GCCGAAGCGA CCGCCGCCCA GGAGGCTGCG ATTCCTGCTC CAGAGCCCGA AACTGAAGTC       360
     AGCGGCGGTA CCGAAGTCGC CATGCCGCAG ATGGGCGAGT CCATCACCGA AGGCACGATC       420
     ACCAAGTGGC TCAAGAATAT TGGCGATACC GTCGCGCGTG ACGAGCCGAT CTTTGAGATT       480
     TCGACGGATA AGGTTGACGC TGAGATTCCG TCGCCCGTCG CCGGCACGTT GACTGAGATC       540
     CGGGTCAAGG AAGGCGCTAC CGTCACCGTC AACACCATCG TTGCGGTGAT CGGCGGAGCG       600
     GCGGGCAGCA AGCCCAAGGC TGCCGCGCCT GCCGCCGTTG CCCCAGCGGC ACCCGCTGCT       660
     GTTGCTGCCG CACCCACGCA GGCTTCGCAG GGCGAGACGC CTCGCTCCTC GCCGCTGGTC       720
     CGCAAGATTG CGGGTGATAA CAACATCGAT CTGCAGCAGG TCTCCGGAAG CGGTTCCGCC       780
     GGGCGCATCA CCAAGGCCGA CATCATGGGC CATCTGGACA AGCCTGCCTC GACCGCTGCT       840
     GCTACTCCGA CGACGGTGCA GCCTTCAGTC TCGGCCGTGC AGTCTGCGCC TGCGACGACC       900
     GCTCCGGCCA AGGCCGCGGC ACCCACGCAG CAGTTGGGCG AGCTGGTTCC GATGACCAAG       960
     ATGCGCTCCA TCATTGCCAA GCGCATGGTG GAATCCAAGC AGACCAGCCC GCACGTTCAC      1020
     ACCGTCTTCA AGGTGGACAT GACGCGCATC GTCAAGCTGC GTGAGCGCGA GAAGAACAAG      1080
     TACGAGCAGC GCAACGGCAC CAAGCTGACC TACATGCCGT TCATCACGCG CGCGGCTGTG      1140
     CAGGCTCTGA AGAAGCACCC CGTGGTCAAC GCCGCCATCC AGGGCGATGC CATTTTCTAC      1200
     AACAAGAACA TCGCCATCGG AATCGCGGTT GCGCTGGAGT GGGGCCTGAT CGTCCCGGTC      1260
     ATCAAGGGCT GCGAGGAGAA GAACTTCCTG GGCGTGGCAC GGTCGATCGT TGACCTGGCC      1320
     GAGCGTGCGC GGACCAAGAA GCTTGCTCCG GACGAAGTCT CCGGCGGCAC CTTTACGATC      1380
     ACCAACGCGG GGATCTTCGG CGAGCAGTTC GGCACGCCGA TCATCAACCA GCCCCAGGCG      1440
     GCCATCCTCG GCGTCGGCGG CCTGAACAAG GAAGCCCTGG TGCTGACGGA TAAGGATGGG      1500
     CAGGACACCA TCGCCATCCG CAACGTGCAG CGCTTCACGC TGGGCTTCGA TCACCGCATC      1560
     GTGGACGGCG CGGACGCAGG CAAGTTCATG AGCGACTTCA AGGCGTATCT CGAGAACTGG      1620
     GCTGAAGACA TCGGCTAA                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page