(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE25

ACIDO1_5.PE25        Location/Qualifiers
FT   CDS_pept        complement(29199..30083)
FT                   /locus_tag="AciX9_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Fjoh_3583"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fjo:Fjoh_3583 hypothetical protein"
FT                   /db_xref="GI:322433684"
FT                   /db_xref="GeneID:10201998"
FT                   /translation="MLAIGFTLLLGAYLFGPGLIARLILGFAVPRKTLVQSRSEEVTRS
FT                   IVQAVVPFGIALVWARATGALQQSGHLTDLQTVFSGIYSTSFFDAHRQDFFSSLHAFCQ
FT                   MNLCLLLRLYLLVVLFALTLNLAIRNYSQLRARLPLGWQKALLATLVLPRVSEWHVLLS
FT                   EMLLPAGDFLDADVLTKSSVLYQGRIQDKMLGADGSLQSITLAKPRRFLRDEFEKAKEA
FT                   DPNVDREAYWRSIAGNLFVLMASDVINLNLKYIHRNPIDFRSSQEERIVLRRLLERLSN
FT                   DETDRDQTDRQAD"
FT                   /protein_id="YP_004215896.1"
     gtgctggcaa tcggtttcac cctgctgctg ggtgcttacc tcttcggccc cggattgatc        60
     gcgcggttga tcctcggctt tgcagtcccg cgtaagaccc tcgtccaaag cagaagcgaa       120
     gaggtcactc gttcgatcgt gcaggctgtc gttccctttg gaatcgccct ggtctgggcg       180
     cgtgccaccg gcgcactcca gcaaagcggc catctcaccg atctgcaaac cgtcttctcc       240
     ggcatctaca gcacatcctt cttcgacgcg caccgccagg acttcttctc cagtcttcac       300
     gccttctgcc agatgaatct gtgcctcttg ttgaggcttt atcttctggt tgttctcttc       360
     gccctcacgc tcaatcttgc catccgcaac tacagccagc ttcgagccag actgcccctg       420
     ggctggcaga aggcgctgct agccacgctg gtcctgccgc gcgtctcaga gtggcatgtg       480
     ctgctctcag agatgctgct gcccgccgga gactttctcg atgcggatgt gctgacgaag       540
     tcctccgtcc tctatcaggg caggattcag gacaagatgc tgggagcgga tggcagcctg       600
     caaagcatca cgctggccaa gccgcggcga ttcctgcgag acgagtttga gaaggcaaag       660
     gaagccgatc ccaacgtgga ccgcgaggcc tactggcgat cgatcgccgg caacctgttt       720
     gtgctcatgg cgtccgacgt catcaacctg aacctgaagt acatccacag aaatcccatc       780
     gacttccgtt cctcgcagga agaacgcatc gtcctgcgca gactgctgga gcggctgagc       840
     aacgatgaga cagaccggga tcagaccgac cggcaggcag actaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page