(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE27

ACIDO1_5.PE27        Location/Qualifiers
FT   CDS_pept        complement(30435..31601)
FT                   /locus_tag="AciX9_0027"
FT                   /gene_family="HOG000034029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; KEGG: aca:ACP_2355
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="GI:322433686"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:10202000"
FT                   /translation="MKAGTPLLPGATIGIFGGGQLGRMMAMAARGMGYRILVLDPDPGC
FT                   PARFIVDGCIEAGWDDSRGAAMLARGCDVVTLEIEQIGERSMASAATFCPVRPGGAMLA
FT                   IIQDRIEQKNWLTKHGFPVGEFRAVRSLDETRAAIAELGRCFCKSATGGYDGRGQGKVG
FT                   FSAEPVTEADVLGAWEALGEGPGVVEKAVHLEREISVMVARSPRGEVKVYPAAWNHHEN
FT                   QILDWSVIPAPIPPSMEAEAREIAYEIADTFQLEGLLAVEMFITQDGELLINELAPRPH
FT                   NSYHESERACVTSQFEQAIRAVCDLPLGDVEVVQPAAIANLLGDLWLNPDGSAREVCFD
FT                   KALAVPGVALHLYEKLKPRKGRKMGHLSAIGATAEQAIERVLRAKAAL"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /protein_id="YP_004215898.1"
     atgaaggctg gaacgcccct gctgccgggc gcgacgatcg ggatctttgg cggcggacaa        60
     ctgggccgca tgatggcgat ggccgcacgc ggcatgggct atcgcatcct ggtgctggac       120
     cccgacccag gctgtccggc gcggttcatc gtcgacggct gcattgaggc cggatgggac       180
     gacagccggg gcgcggcgat gctggcgcgc ggctgcgacg tcgtcacgct cgagatcgag       240
     cagatcggcg agcgcagcat ggcctctgcc gcgaccttct gcccggtgcg tccgggtggc       300
     gcgatgctcg ccatcatcca ggaccggatc gagcagaaga actggctgac caaacatggt       360
     ttccccgtag gcgaattccg cgcggtgcgg tcgctcgatg aaacgcgcgc ggcgatcgca       420
     gagctgggcc gctgcttctg caagagcgca accggcggct acgacgggcg cgggcaaggc       480
     aaggtcggct tcagcgcaga gccggtcacc gaggcggacg tgctcggggc atgggaggct       540
     ctgggcgaag ggccgggagt cgtagagaag gccgtccacc tggagcgcga gatcagcgtc       600
     atggtcgccc gcagtccgcg gggcgaggtg aaggtctatc ccgccgcctg gaaccaccat       660
     gaaaaccaga tcctggactg gagcgtgatc cccgcgccga ttcctccatc catggaggcc       720
     gaggcgcgtg agatcgcata cgagatcgcc gataccttcc agctcgaagg cctgctggcc       780
     gtggagatgt tcatcacgca ggatggcgag ctgctgatca acgagctcgc cccgcgtccg       840
     cacaacagct atcacgagag tgaacgcgcc tgcgtgacca gccagttcga gcaggccatc       900
     cgcgccgtct gcgacctgcc cctgggtgat gtcgaggtcg tccagcctgc ggcaatcgcc       960
     aatttgctgg gcgatctatg gctcaatccc gacggttcag cgcgcgaggt ctgcttcgat      1020
     aaagcgctag ccgtaccggg cgtggcgctg catctgtacg agaagctgaa gccgcgcaag      1080
     ggccggaaga tgggccattt aagcgcaatc ggcgcaacag cggagcaggc catcgagcgc      1140
     gtgctgcggg cgaaggctgc gctctag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page