(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE28

ACIDO1_5.PE28        Location/Qualifiers
FT   CDS_pept        complement(31607..32104)
FT                   /locus_tag="AciX9_0028"
FT                   /gene_family="HOG000034141" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: aca:ACP_2356
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="GI:322433687"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="GeneID:10202001"
FT                   /translation="MPLVGVVMGSRSDYAVMKAAVDVLREFGVPYEAKVVSAHRTPELM
FT                   VEYAQTAIARGLRVIIAGAGGAAHLPGMIAALTVVPVLGVPVSATSLQGLDALLSIVQM
FT                   PKGVPVGTLAIGASGAANAGLLAVAMLATTDAELQQKLIARREATRDKVLGESLEEDEV
FT                   KA"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /protein_id="YP_004215899.1"
     atgccgctgg ttggcgtggt aatgggaagc cgcagtgatt atgcggtgat gaaagcagcg        60
     gtggatgtgc tgcgggagtt tggcgtgccg tatgaggcca aggtggtcag tgcgcaccgc       120
     acgccggagc tgatggtgga gtacgcgcag acggcgatcg cacgcggtct gcgcgtgatc       180
     atcgccgggg ccggcggggc cgcgcacctg ccgggcatga tcgccgcgct gacggtggtg       240
     ccggtgcttg gggtgccggt gtccgccact tcattgcaag gtttagacgc gctgttgagc       300
     atcgtgcaga tgcccaaggg cgtgccggtg gggacgctgg cgatcggtgc ttccggcgct       360
     gcgaacgcag gtctgctggc cgtagcgatg ctcgccacaa ccgatgcgga gctgcagcag       420
     aagctgatcg cacggcgcga ggcgacacgg gataaggtgc tgggcgagtc gcttgaagaa       480
     gacgaggtga aggcgtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page