(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE3

ACIDO1_5.PE3         Location/Qualifiers
FT   CDS_pept        3078..4271
FT                   /locus_tag="AciX9_0003"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: aca:ACP_2196 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:322433662"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10201976"
FT                   /translation="MPTLTEDSETNTNVAAPTGNLEITVSRAELLRELTAAQSVVERKT
FT                   TIPILSNFLFEASNEGETGRLTITATDLDQSLRTSCAAKVKKAGACTIPARKLYDYIRL
FT                   LPEGEISIKLMDNHWVQIRAGRSNTKMVGMARANFPQVAEFPASGAYTLSVASLKTMVS
FT                   KTIFAISNEESRYTLNGALLVLKAESMAMVATDGHRLAHVEKLGETLEGISGEKKTLIP
FT                   RKALSELSSLLNSTDAETMQFADDDSTLFFKMGGRVLTSRKLTGQFPNYEAVLPRDNNK
FT                   FVIVRSEDLMSAIQRVAQFADERSGAIKIRLEQNELRLSSSSTDSGESEDTIETPYNYD
FT                   PLVVGFNSQYLIDFLKAIGNTGEVRLEFKDAQSAGQMRPEDGNEDVKYRYILMPMRI"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_004215874.1"
     GTGCCTACCT TGACCGAAGA TTCCGAGACC AACACGAACG TAGCGGCACC GACCGGCAAC        60
     CTGGAGATCA CGGTGTCTCG CGCGGAGCTG CTGCGTGAGC TGACCGCGGC GCAGTCCGTG       120
     GTGGAGCGGA AGACGACGAT TCCGATTCTT TCGAACTTCC TGTTCGAGGC CTCGAACGAA       180
     GGGGAGACGG GGCGGCTGAC GATTACGGCG ACTGACCTGG ACCAGAGCCT GCGGACGAGC       240
     TGCGCGGCGA AGGTGAAGAA GGCCGGGGCA TGCACGATTC CGGCGCGGAA GCTGTACGAC       300
     TACATCCGGC TGCTGCCTGA GGGCGAGATC TCGATCAAGC TGATGGATAA CCACTGGGTG       360
     CAGATCCGTG CGGGCCGCTC CAACACGAAG ATGGTTGGAA TGGCGCGGGC GAACTTCCCG       420
     CAGGTGGCGG AGTTTCCGGC GAGCGGGGCG TATACGCTTT CGGTTGCGAG CTTGAAGACG       480
     ATGGTCTCGA AGACGATCTT TGCGATCTCG AACGAGGAGA GCCGGTATAC GCTGAACGGT       540
     GCGCTGCTGG TGCTGAAGGC TGAGTCGATG GCGATGGTGG CGACGGATGG CCATCGGCTG       600
     GCGCATGTCG AGAAGCTGGG CGAGACGCTG GAAGGTATCT CCGGCGAGAA GAAGACCTTG       660
     ATTCCGCGGA AGGCGCTGAG CGAGCTTTCC TCGCTGCTGA ACTCGACCGA CGCGGAGACG       720
     ATGCAGTTTG CGGATGACGA CTCGACCCTG TTCTTCAAGA TGGGTGGCCG GGTGCTGACG       780
     AGCCGGAAGC TCACCGGCCA GTTCCCGAAC TATGAGGCTG TGCTGCCGCG GGATAATAAC       840
     AAGTTCGTCA TCGTGCGGAG TGAAGACCTG ATGAGCGCGA TTCAGCGTGT GGCGCAGTTT       900
     GCCGACGAGC GCTCGGGTGC GATCAAGATC AGGCTGGAGC AGAACGAGCT TCGGCTTTCG       960
     TCTTCGTCGA CTGACTCGGG TGAGTCGGAG GACACGATTG AGACGCCTTA CAACTACGAT      1020
     CCTCTGGTCG TCGGGTTCAA CTCGCAGTAT CTGATCGACT TTTTGAAGGC GATTGGGAAT      1080
     ACGGGTGAGG TTCGGTTGGA GTTCAAGGAC GCGCAGAGCG CAGGGCAGAT GCGGCCGGAG      1140
     GACGGCAACG AAGACGTCAA GTACCGCTAC ATCCTAATGC CAATGAGGAT TTGA            1194
//

If you have problems or comments...

PBIL Back to PBIL home page