(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE30

ACIDO1_5.PE30        Location/Qualifiers
FT   CDS_pept        complement(32604..32939)
FT                   /locus_tag="AciX9_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Paes_0284"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: paa:Paes_0284 50S ribosomal protein L11"
FT                   /db_xref="GI:322433689"
FT                   /db_xref="GeneID:10202003"
FT                   /translation="MAGRFVKGTTDEPEESTSLGRKGVRNPRFFKTFARKQFAEALPVI
FT                   VSVLLDKAKSGSVSHLKLLVELSGLEKDPDPKKMKPRGKSLEAILTEQWAKDKAEAALK
FT                   PATGGWR"
FT                   /protein_id="YP_004215901.1"
     gtggcgggcc ggtttgtaaa aggaacgacc gacgagccgg aggaatcgac gagcctcggg        60
     cgcaaagggg tgaggaaccc gaggttcttc aagacctttg cccggaagca gtttgccgag       120
     gctctaccgg tgattgtgtc cgtgcttctg gacaaggcga agagcggaag cgtgtctcac       180
     ctgaagctgc tggtcgagtt gagcgggttg gagaaagatc cggacccgaa gaagatgaaa       240
     ccgagaggca agagcctgga ggcgattctg acggagcagt gggcgaagga taaggcggag       300
     gctgctttga agcctgcgac gggaggatgg cgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page