(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE31

ACIDO1_5.PE31        Location/Qualifiers
FT   CDS_pept        complement(33207..33788)
FT                   /locus_tag="AciX9_0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_2372"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_2372 hypothetical protein"
FT                   /db_xref="GI:322433690"
FT                   /db_xref="GeneID:10202004"
FT                   /translation="MSAALVILPVIQAMAEVASRPAAGPISATGAALRKGPHRLTLVRA
FT                   SAAVLPDAEERIRLRPSPELSFYRKYTEAMLKRYTKLSMEAGRAPSLLGRELFRGHVTN
FT                   YKVSSFDDVVIYVHDVENCVAKLGRGQQYLVRKIAMQGYTQQETAAMIGTNLKIVIKRY
FT                   VEAIDLLTRLFLDLGLLAPTVASKRVTEGQ"
FT                   /protein_id="YP_004215902.1"
     atgagtgcag ctcttgtgat cctgcctgtg atccaggcga tggctgaggt tgcttcacgg        60
     ccggctgcgg ggccgatctc cgcgacgggc gcggctttgc gcaagggtcc tcatcgtctg       120
     acgctggtgc gggcttccgc cgccgtcctg ccggatgccg aggagcggat tcggctgcgg       180
     ccttctcctg agctttcgtt ctaccgcaag tacacggagg cgatgcttaa gcggtacaca       240
     aagctgtcca tggaggccgg cagggctcct tccctgctgg gccgcgagct gtttcgcggt       300
     catgtgacca actacaaggt cagcagcttc gacgacgtgg tgatctatgt ccacgacgta       360
     gaaaactgcg tggcaaagct gggccggggt cagcagtacc ttgtccggaa gatcgcgatg       420
     caggggtaca cccagcagga gacggcggcg atgatcggga cgaatctgaa gatcgtcatc       480
     aagcgatacg tggaggccat cgatctgctg acccgcctgt ttctcgacct tgggctgctt       540
     gctccaactg ttgcaagtaa aagggttacc gaggggcagt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page