(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE35

ACIDO1_5.PE35        Location/Qualifiers
FT   CDS_pept        complement(37914..39794)
FT                   /locus_tag="AciX9_0035"
FT                   /gene_family="HOG000283740" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF885"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   xac:XAC2543 hypothetical protein"
FT                   /db_xref="GI:322433694"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="GeneID:10202008"
FT                   /translation="MRAPRVLVAVSMLSAVALATAQAPAMKPATAKPATTAKPAMTTAP
FT                   AAKTEDSNPAPISPFPQGPPSKPGLELKTIHTEDRKWREAQRGYVDPRRMNRIQPKELR
FT                   SVDAATQAKEYDHLKGVMAQLEKLPVAEMNESEKINLEIYRYQIESQMSGQYFKEWEKP
FT                   VSSLESFWANAQGTGERGFRTEQDYLNYLTWLADIPRYYDENIANMRAGLARGFTPPKI
FT                   TLNGRDQTIAPIAKATSADQTPFWKAFVHMPSTINTAEQARLRAEGKKVIESTVIPEYK
FT                   KLLPFWTDEYYPKTVTSIAATDLPDGKAYYKAQIKRYTTLDLSADDLHAFGIAEVAKIH
FT                   QEMLDTMVEAKFTGDFAAFQKFLRTDPQFYPKTKEELLGDVSYMMKEFDDKSDRYFGYQ
FT                   PRGRFGVHPVPDEVAPYQPAGFGGAGGFSINLYDLPSRPLYGMPALVLHEAAPGHSWAG
FT                   LIAREHADPDGFRGGGSAFGEGWALYCERLGTEMDMYHTPYEKFGMLSFQSWRASRLVV
FT                   DTGMHAMGWTREQGQQYLRDNTVLSEHDIEEEIDRYISWPGQALSYYMGMTEILKERKH
FT                   AQEVLGPKFNLRAFHDAILATGGLPLPVLDEYLEAWIKGGGIGPYPEMEK"
FT                   /protein_id="YP_004215906.1"
     atgcgtgcac cacgtgtttt ggtagcggtg tcgatgttgt cagccgtggc attggcgact        60
     gctcaggcac cggctatgaa gccggcgaca gcaaaaccgg caacgaccgc taaaccggct       120
     atgacaacag ctcctgccgc gaagaccgag gatagcaatc cggctccaat ctcgccgttt       180
     cctcaagggc ctccgtccaa gcccggcctg gagctgaaga cgatccacac agaggaccgg       240
     aagtggcggg aggcgcagcg gggctacgtc gatccgcgga ggatgaacag gattcagccg       300
     aaggagctcc gctccgtcga tgcggccacg caggcgaagg agtatgacca tttgaagggc       360
     gtgatggcgc agctagagaa gctgccggtt gcggagatga acgagtcaga gaagatcaac       420
     ctggagatct accgttatca gattgaatcg cagatgtccg ggcagtactt caaggagtgg       480
     gagaagccgg tgagctcact ggagtcgttc tgggcgaatg cgcaagggac gggagagcgt       540
     gggttccgga ccgagcagga ctacctgaac tacctgacat ggctggcgga tattccgcgg       600
     tactacgacg agaatatcgc caacatgagg gcggggctgg cgcgcggctt cacaccgccg       660
     aagattacgc tgaacgggcg cgaccagacg attgcgccca tcgccaaggc gacgagtgcg       720
     gaccagacgc cgttctggaa ggcattcgtg catatgcctt ccaccatcaa cacggcggag       780
     caggcaaggc tgcgcgcgga ggggaagaag gtcattgaaa gcacggtgat cccggagtat       840
     aaaaagctgc ttcccttctg gaccgacgag tattacccga agacggtgac ctcgattgcc       900
     gcgacggatc tgcccgatgg gaaggcttac tacaaggccc agatcaagcg ttatacgacg       960
     ctggatctgt ccgcggatga tctgcacgcg tttggcattg ccgaggtcgc gaagattcac      1020
     caggagatgt tggacaccat ggtggaggcg aagttcacag gcgactttgc cgcattccag      1080
     aagtttctaa ggaccgatcc gcagttctat ccgaagacca aggaagagct gctgggagac      1140
     gtctcttaca tgatgaagga gttcgacgat aagtctgacc ggtactttgg ctatcagcca      1200
     cggggacggt ttggcgtgca tccggttccg gatgaggttg cgccgtatca gccggcaggc      1260
     ttcggcggag caggtggttt ctcgatcaac ctgtacgacc ttccttcgcg gccgctgtac      1320
     ggaatgcccg cgctggtact gcatgaggca gctccgggtc actcctgggc aggcttgatt      1380
     gcgcgggagc atgctgatcc ggatggcttt cgcggaggcg gatcagcctt tggcgaaggg      1440
     tgggcgctct actgcgagcg gctgggcacc gagatggata tgtatcacac gccctatgaa      1500
     aaattcggga tgttgagctt ccagtcctgg cgtgcatcgc ggctggtggt cgatacgggc      1560
     atgcatgcga tgggctggac ccgtgagcaa gggcagcagt accttcgcga caatacggtg      1620
     ctgagtgagc acgatattga agaagagatc gaccgctata tctcatggcc gggacaggcg      1680
     ctgagctact acatggggat gactgagatc ctgaaggagc gcaagcacgc gcaggaggtg      1740
     ctggggccga agttcaacct tcgcgccttc cacgatgcga ttctcgcgac cggcgggctg      1800
     ccgctgccgg tgctggatga atatctggag gcgtggatca agggcggcgg cattgggccg      1860
     tatccggaga tggagaagta g                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page