(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE37

ACIDO1_5.PE37        Location/Qualifiers
FT   CDS_pept        40734..44015
FT                   /locus_tag="AciX9_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain-containing protein;
FT                   KEGG: aba:Acid345_3005 TPR repeat-containing protein"
FT                   /db_xref="GI:322433696"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="GeneID:10202010"
FT                   /translation="MQTSHLSSTLFLCFASFVSATLPAQQLPADVTVQKLPISPPPSSP
FT                   ASAASEYAGESAVVDRSELIYAMNADGTGYSEHSMAIRVQSEAAVRELGIVNVPFASAS
FT                   EKVEIQYVRVRRPDGTVLQTAVSAALEQPQAVTREAPFYSDLKQMQLPVKSLRAGDTLE
FT                   WKVRITRTKAEAPGQFWSQDTFVSQGIALSETLELRIPKDTSVNVWTNPALNLKPIEKV
FT                   DGNQHVYRWESKSLKPTTGPEAEAEKKRKEKELWTADQELDAKEGALPSVAWTTFKSWE
FT                   AVGAWYRGLEGDRMMPDDTLKAKVAELTAGKTTLEEKVRAVYGFVGPQVRYIGVAFGVG
FT                   RYQPHHAEEVLENQYGDCKDKHTLLAAMLTVLGLHPDAVLIGSGIRFNEAVPSPAAFNH
FT                   LITHVMIDGKETWLDTTAEVAPYRMLNSTIRDKQALVVPETGTAKLEKTPADPPFPSYQ
FT                   RLKAVGMLDQDGVSNSRLVLTVRGDDELVLRAVLHQIAPAQYDELTQRVSQSMGYGGTA
FT                   SHAEISRPEDTAGPLEMSYDYKREKAGDWNNYRIVAQLMPVSLPMVDEKDPPVQSIDLG
FT                   VPRILSSTAEMKLPSGWGVELPEAIHEKAAFATYDMSFRFDKGTLYSERKVVVLQQKIG
FT                   VKDWKSYKKWQDAVGLGGDPFIQLTRVDARTDHASGKEGGTSNGPPAPAVTNAEAVKLI
FT                   QQAFTAMRKMDVGEAQPLLDKAKGLNDQERLLWAGYGYLAELRGAEQEAATDYRKELSL
FT                   HPDSYQVYRSLVGSQLRSGKRKDAMETLRSWQTADTSDPAPAMQLSAMQLADGNASAAV
FT                   ETMNSSIAKLPEEKRTEPRVILALCQAEMKNGMEAKASASMLELLKTSEDSGVLNDAAY
FT                   FLSETGHELPASETAMHKALSQMNAETESWTLDESPQVLAQQTSLLIAAWDTMGWILFH
FT                   EGKLSEARSYVEAAWVNEGHAVVGEHLGDIQMAMGEFTLAIQTFELAKKGGGPASELNE
FT                   RQNNAKKAGGKSTSMDAGKELKELRTVKLGSSKGHDGAAEYKVLLADEKVVRVEATGAK
FT                   TVEGGAEMIEKMQLPQMFPKGSTARLAKSGLLDCYEETCAFIFKP"
FT                   /protein_id="YP_004215908.1"
     ATGCAAACTT CTCATCTGAG CTCTACCCTG TTTCTCTGCT TTGCTTCTTT CGTCTCTGCC        60
     ACCCTTCCCG CGCAGCAGCT TCCAGCGGAC GTAACCGTCC AGAAGCTGCC CATCTCTCCG       120
     CCTCCTTCTT CACCTGCGAG CGCTGCAAGC GAGTATGCGG GCGAGTCGGC CGTGGTTGAT       180
     CGGTCTGAGC TGATCTATGC AATGAATGCG GATGGCACGG GCTATAGCGA GCATTCGATG       240
     GCGATCCGCG TCCAGTCAGA GGCCGCGGTC CGCGAGCTTG GCATCGTCAA CGTCCCGTTT       300
     GCGAGTGCGT CGGAGAAGGT TGAGATCCAG TATGTGCGGG TGCGCCGGCC GGATGGCACT       360
     GTCCTCCAGA CAGCCGTATC CGCTGCTCTG GAGCAGCCAC AAGCGGTCAC CCGCGAGGCC       420
     CCGTTCTACA GCGATCTGAA GCAGATGCAG CTTCCCGTCA AGAGTCTCCG CGCAGGCGAC       480
     ACGCTGGAGT GGAAGGTCCG CATCACCCGC ACCAAGGCGG AGGCACCGGG CCAGTTCTGG       540
     AGTCAGGACA CCTTTGTCAG CCAGGGGATC GCGCTCTCTG AGACGCTCGA GCTTCGCATC       600
     CCCAAAGACA CCTCCGTCAA TGTCTGGACC AACCCAGCGT TGAATCTCAA ACCAATCGAG       660
     AAGGTTGATG GAAATCAGCA CGTCTACCGG TGGGAGTCGA AGTCGCTCAA GCCGACCACC       720
     GGCCCCGAGG CGGAGGCTGA AAAGAAGCGT AAGGAGAAAG AGCTCTGGAC CGCGGATCAG       780
     GAGCTTGATG CGAAGGAGGG AGCGCTGCCC AGTGTGGCCT GGACGACCTT CAAAAGCTGG       840
     GAGGCGGTAG GAGCCTGGTA TCGCGGCCTG GAAGGCGATC GCATGATGCC GGACGATACC       900
     CTGAAGGCCA AGGTAGCGGA GCTGACGGCC GGGAAGACGA CCCTGGAAGA AAAGGTCCGC       960
     GCAGTCTATG GCTTTGTGGG CCCGCAGGTC CGGTACATCG GCGTCGCGTT CGGGGTGGGG      1020
     CGGTACCAGC CGCATCACGC TGAGGAAGTG CTGGAAAACC AGTATGGGGA TTGCAAGGAC      1080
     AAGCACACGC TGCTGGCCGC GATGCTCACT GTGCTCGGGC TGCATCCGGA TGCGGTGTTG      1140
     ATCGGCTCAG GCATCCGCTT CAATGAGGCC GTACCCTCGC CCGCCGCGTT CAATCACCTC      1200
     ATCACGCACG TGATGATCGA TGGCAAAGAG ACCTGGCTGG ATACGACGGC GGAGGTCGCC      1260
     CCTTATCGGA TGTTGAACTC CACGATCCGT GACAAGCAGG CGCTGGTGGT GCCGGAGACC      1320
     GGCACGGCGA AGCTGGAGAA GACTCCCGCG GACCCGCCCT TTCCCTCTTA CCAGAGGTTG      1380
     AAGGCAGTGG GGATGTTGGA TCAGGATGGC GTTTCCAACT CTCGTCTGGT CTTGACGGTG      1440
     CGGGGGGATG ACGAGTTGGT GTTGCGCGCG GTGCTGCACC AGATTGCTCC CGCCCAGTAC      1500
     GACGAACTCA CGCAGCGTGT CTCCCAAAGC ATGGGATACG GTGGCACGGC CAGCCACGCG      1560
     GAGATCAGCC GCCCTGAAGA TACAGCGGGG CCACTGGAGA TGAGCTACGA CTACAAGCGT      1620
     GAAAAGGCCG GCGATTGGAA TAACTACAGA ATCGTTGCGC AGCTGATGCC TGTCTCCCTA      1680
     CCGATGGTCG ATGAGAAAGA TCCCCCGGTG CAGTCGATTG ATCTGGGAGT CCCGCGAATC      1740
     CTATCAAGTA CGGCTGAAAT GAAGCTCCCG TCTGGCTGGG GCGTTGAACT ACCAGAGGCT      1800
     ATCCACGAGA AAGCGGCCTT TGCCACTTAC GATATGAGCT TCCGTTTTGA TAAAGGGACC      1860
     TTGTATTCGG AGCGCAAGGT CGTCGTACTT CAGCAGAAGA TTGGGGTAAA GGATTGGAAG      1920
     AGTTATAAAA AGTGGCAGGA CGCGGTCGGC CTTGGTGGAG ACCCGTTCAT TCAATTGACC      1980
     AGAGTCGACG CCAGGACGGA TCACGCATCA GGCAAAGAGG GCGGAACTTC CAACGGACCC      2040
     CCCGCGCCGG CCGTGACCAA CGCAGAGGCT GTGAAGCTGA TTCAGCAGGC CTTTACAGCG      2100
     ATGAGGAAGA TGGATGTGGG TGAGGCGCAA CCCTTGCTCG ATAAGGCGAA AGGCCTCAAC      2160
     GATCAGGAAC GATTGCTCTG GGCAGGCTAT GGGTATTTGG CTGAGCTGCG CGGCGCGGAG      2220
     CAGGAGGCAG CCACTGACTA CCGCAAGGAG TTGTCCCTCC ATCCAGACTC CTACCAGGTC      2280
     TACCGTTCCC TGGTAGGAAG CCAGTTAAGA TCCGGCAAGC GCAAGGATGC GATGGAGACG      2340
     CTGCGAAGCT GGCAGACAGC GGATACGAGC GATCCGGCTC CGGCAATGCA ATTGAGCGCC      2400
     ATGCAGTTGG CTGATGGCAA TGCGTCGGCT GCGGTAGAGA CTATGAACTC TTCCATCGCG      2460
     AAGCTTCCGG AAGAGAAACG AACTGAACCC CGTGTGATCC TCGCACTTTG CCAGGCAGAG      2520
     ATGAAGAACG GAATGGAAGC CAAGGCCTCT GCCTCTATGC TGGAGCTGCT GAAGACTTCT      2580
     GAGGACTCGG GTGTTCTGAA CGATGCTGCT TACTTCCTGT CTGAGACCGG CCATGAACTG      2640
     CCTGCCTCTG AGACGGCGAT GCACAAGGCG TTGAGCCAAA TGAATGCAGA GACGGAAAGC      2700
     TGGACTCTCG ACGAATCGCC GCAGGTTCTG GCGCAGCAGA CCTCTCTTCT GATAGCCGCG      2760
     TGGGACACCA TGGGATGGAT ACTCTTTCAT GAAGGCAAGC TTTCGGAGGC CCGCAGCTAC      2820
     GTGGAAGCTG CGTGGGTCAA CGAAGGCCAC GCGGTCGTCG GTGAGCATCT GGGTGACATC      2880
     CAGATGGCAA TGGGAGAGTT CACGCTGGCC ATCCAAACCT TTGAACTGGC AAAGAAGGGC      2940
     GGCGGTCCTG CTTCGGAGCT GAATGAGCGG CAGAACAACG CGAAGAAGGC GGGCGGGAAG      3000
     AGTACCTCCA TGGATGCCGG GAAGGAGTTG AAAGAACTCA GGACCGTGAA GCTGGGGTCT      3060
     TCTAAGGGAC ATGACGGAGC GGCGGAGTAC AAGGTCCTTC TGGCGGATGA AAAGGTCGTG      3120
     CGGGTTGAGG CAACGGGAGC CAAGACAGTC GAAGGCGGCG CGGAGATGAT TGAGAAGATG      3180
     CAGCTGCCTC AGATGTTTCC GAAGGGATCA ACGGCCAGAC TGGCGAAGAG CGGGCTTTTG      3240
     GACTGTTATG AGGAAACATG CGCTTTCATC TTCAAGCCTT GA                         3282
//

If you have problems or comments...

PBIL Back to PBIL home page