(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE38

ACIDO1_5.PE38        Location/Qualifiers
FT   CDS_pept        complement(44027..46171)
FT                   /locus_tag="AciX9_0038"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA topoisomerase III; PFAM: DNA
FT                   topoisomerase type IA central domain protein; TOPRIM
FT                   domain-containing protein; DNA topoisomerase type IA zn
FT                   finger domain protein; KEGG: drm:Dred_0974 DNA
FT                   topoisomerase III; SMART: DNA topoisomerase I DNA-binding;
FT                   DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="GI:322433697"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003916"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="GeneID:10202011"
FT                   /translation="MRVFLAEKPSVAREIAQALGCTHKEQGFFRGKNDLVTWAIGHLVR
FT                   FAEPGEMNPAWGKPWRREALPMLPKDGGWLLIPEPRTEDQFNVVARLFGDKRITQIVNA
FT                   TDAGREGEAIFRRIYALSGASKPVLRFWTSSLTEEAIASALSHLRPAADYDNLASAALT
FT                   RAQLDWLIGMNHSRAATLHNSVTCSVGRVQTPTLAMIVRRHHEIAGFIKTFFYEVHADL
FT                   GEFVARAVNSQQKHDFEIKAEAETILRDVPSDTLATVTLVEVKKNRKAPPQLHNLGELQ
FT                   KEANRRFGFPADRTLAIAQSLYESKAITYPRSSSRHLSEDMVDGLPAVLKALRLGEERA
FT                   SYVKQALHRAQHGPALSKRFVDGSKLSDHHAIIPTAKPAPASLSGDERKVYTIVAERFL
FT                   AIFLPDKETEDTRIDLEIAKHPFRARGSRLIAPGWTVLTGNQDFENKAADAEDRQALPA
FT                   VKKGDELEVVESELVTKERKPPSRYTDATLLAAMETAGREIDDDELREAMKGRGLGTEA
FT                   TRAAIIQRLLDLAYVIRDGKQFEPTGKGIALIAQVLPHLASPELTGDMEAKLNLVEAGQ
FT                   LDAAEILAEVSESLRHEIPAVFRSKPMQAPDAPRITAGKDELLCPKCKAGLVTKRSTPN
FT                   ASAPFYGCARFHDGCNFTINTVVAKKTLTETNIKDLCSPTRHHTTKIIKGFTSKAGKKF
FT                   DAFLQLSSATDFKTEFVFPR"
FT                   /protein_id="YP_004215909.1"
     atgcgcgtct tcctggccga gaaaccgtcc gtagcccgag agatcgccca ggccctcggc        60
     tgcacccata aggaacaagg cttctttcgc ggcaaaaacg accttgtcac ctgggccatt       120
     ggccaccttg tccgcttcgc ggagcccggc gagatgaacc ccgcatgggg caagccgtgg       180
     cgtcgcgaag ccctccccat gctcccaaag gacggcggtt ggctcctcat cccagagcct       240
     cggacggaag accagttcaa cgtcgtagcc cgtttgttcg gggataagcg catcacccag       300
     atcgtcaacg ccaccgacgc cggacgcgag ggcgaagcca tcttccgccg catctacgcc       360
     ctctccggag cttccaagcc cgttctccgc ttctggacct catctttgac ggaagaggct       420
     atcgcgtctg cccttagtca cttaagaccc gccgccgact acgacaacct ggcctctgct       480
     gcgctgaccc gcgctcagct cgactggctg atcggcatga atcacagccg agccgcgacg       540
     ctgcataatt cagtcacctg cagcgtcggt cgggttcaaa ctcctacact cgcgatgatc       600
     gtgcggcggc atcatgagat agccgggttc atcaagacct tcttctatga ggtccatgcg       660
     gatctcggtg agttcgtggc gagagccgtc aactctcagc aaaagcacga cttcgaaatc       720
     aaagccgaag cggagaccat cctccgcgat gtgccttctg acaccctcgc caccgtaacg       780
     ctggtggagg ttaagaagaa ccgcaaagcg ccgcctcagc ttcacaacct gggtgaattg       840
     cagaaagagg cgaaccggcg cttcggtttt cctgcggaca ggaccctggc catcgcgcaa       900
     tcgctctacg agagcaaggc gatcacctat ccacgaagtt cgtcgagaca cctgtccgag       960
     gatatggtgg acggtctgcc ggcggtgctg aaggcgctgc ggctgggtga ggagcgtgcg      1020
     tcttatgtga agcaggcgct gcaccgggca cagcatggtc ccgcgctgtc gaagcggttt      1080
     gtggacgggt ccaagctgtc cgatcaccat gcgattattc cgacggccaa gcctgctccg      1140
     gcgagtctgt cgggcgacga gcggaaggtt tatacgatcg tcgcggaacg cttccttgcg      1200
     atctttctgc cggacaagga gacggaggat acgcggatcg atctggagat tgcgaagcat      1260
     ccgtttcggg cgcgtgggtc gaggctgatc gctccggggt ggacggtgct gacaggcaac      1320
     caggactttg agaacaaggc ggcggatgcg gaggatcgtc aagcgctgcc ggcggtgaag      1380
     aagggcgacg agctggaggt ggtggagtcc gagctggtga cgaaggagcg caagccgccc      1440
     tcgcgctata cggacgcgac gcttcttgcg gcgatggaga ctgccggacg cgagatcgac      1500
     gacgacgaac tacgcgaggc catgaagggc cgtggcctgg gaacggaggc cacgcgtgcc      1560
     gcgatcatcc agcgtctgct ggatcttgct tacgtcatcc gcgatgggaa gcagttcgag      1620
     cctaccggca agggcatcgc actcatcgca caggttctgc cgcatcttgc gagtccggag      1680
     ttgacggggg atatggaggc caagctcaat ctggtcgaag ccgggcagct cgatgccgcc      1740
     gagatccttg ccgaggtctc cgagagcctg cgccacgaga ttccggccgt cttccgctcc      1800
     aagcccatgc aggctcctga tgcgccccgc atcactgcgg gcaaggatga gcttctctgc      1860
     cccaagtgca aggccggtct ggtcaccaag cgctcgaccc ctaacgccag tgcgcccttt      1920
     tatggctgcg cccgctttca cgatggctgc aacttcacga tcaataccgt cgtcgcgaag      1980
     aagaccctga cggagaccaa catcaaggac ctctgctcgc ccactcggca tcacacgacc      2040
     aagatcatca agggctttac gtcaaaggca gggaagaagt ttgacgcgtt cctgcagctc      2100
     agttccgcca ccgacttcaa gaccgagttt gtttttcctc ggtga                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page