(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE39

ACIDO1_5.PE39        Location/Qualifiers
FT   CDS_pept        46312..47112
FT                   /locus_tag="AciX9_0039"
FT                   /gene_family="HOG000167590" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_2539"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_2539 hypothetical protein"
FT                   /db_xref="GI:322433698"
FT                   /db_xref="GeneID:10202012"
FT                   /translation="MMGRFGIALLLVLGASVGILRGQGTAAPGAIGDAPLLPEYREAPL
FT                   PPAYGGVQVRIPGIYVTPVVNAPFTAKVQIVSQEQLPDGTVRVRKTVNHIARQSSGRIY
FT                   NERRQLVAPTFQGEPRLISAHIYDPSTRLNTYLNPVTHIAQEIRMKQAAVAPNYGTTRM
FT                   GVGKNPLLKEEELGEQALGPVMLRGIRRSRTVPAAVSGTGKDVVVVDEYWYSAELEIYM
FT                   IIKHNDPRTGEQIVAVSDVERGEPDGKQFVVPGNYKRVDETPVD"
FT                   /protein_id="YP_004215910.1"
     ATGATGGGTC GTTTTGGGAT TGCTTTGCTG TTGGTGCTGG GTGCATCGGT GGGGATATTG        60
     CGGGGGCAGG GGACCGCAGC GCCGGGGGCG ATTGGAGATG CGCCTTTGCT GCCGGAGTAT       120
     CGGGAGGCTC CGCTGCCGCC TGCGTATGGC GGGGTGCAGG TGCGGATTCC GGGGATCTAT       180
     GTGACTCCGG TGGTGAATGC TCCGTTTACG GCGAAGGTGC AGATCGTGTC GCAGGAGCAG       240
     TTGCCGGATG GGACGGTGCG GGTTCGCAAG ACGGTGAACC ATATTGCGCG GCAGAGCTCG       300
     GGGCGGATCT ATAACGAGCG GCGGCAGTTG GTGGCTCCGA CGTTTCAGGG CGAGCCGCGG       360
     CTGATTTCGG CGCATATTTA TGATCCATCG ACGCGCCTGA ACACTTACCT GAATCCGGTG       420
     ACGCATATCG CGCAGGAGAT TCGGATGAAG CAGGCTGCCG TGGCTCCGAA CTACGGGACG       480
     ACGCGGATGG GTGTGGGTAA GAATCCGCTG CTGAAAGAAG AGGAGCTTGG GGAACAGGCT       540
     CTGGGGCCGG TGATGCTGCG GGGGATTCGG CGATCACGGA CGGTGCCGGC TGCGGTGAGT       600
     GGGACGGGTA AGGATGTCGT GGTGGTGGAT GAGTACTGGT ACTCGGCTGA GCTGGAGATT       660
     TACATGATCA TCAAGCACAA CGATCCGCGT ACGGGCGAGC AGATCGTGGC GGTCTCTGAT       720
     GTGGAGCGCG GGGAGCCGGA TGGGAAGCAG TTTGTGGTGC CGGGGAACTA CAAACGGGTG       780
     GATGAGACGC CGGTGGATTA G                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page