(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE4

ACIDO1_5.PE4         Location/Qualifiers
FT   CDS_pept        4437..5207
FT                   /locus_tag="AciX9_0004"
FT                   /gene_family="HOG000115862" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid_5553"
FT                   /codon_start="1"
FT                   /product="peptidase M56, BlaR1"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_5553 peptidase M56, BlaR1"
FT                   /db_xref="GI:322433663"
FT                   /db_xref="InterPro:IPR017801"
FT                   /db_xref="GeneID:10201977"
FT                   /translation="MVKLEAWRWVAVTCFGLTAYGFSQEKATPLTFEVATVRLTKPGEL
FT                   DGWIKALPGGAEYTAHNIPVKLMISLMYKVPMRQISGGPDWMETDKYDVEAKADKSYSL
FT                   DDLHTMYRGLLAERFHLKVRKEIHEGPVYALTVDKGGVKMKPDLSEQSYAIPITYSGEG
FT                   AVGNRVPMSYLSWWLGQQLQSESRPVVDETGLKENFDFTLSFTPPRLEGTDGGAAEKPS
FT                   LFTAVKEQLGLKLEAQKGPVEYYVIEHIERPSAN"
FT                   /protein_id="YP_004215875.1"
     ATGGTGAAGC TCGAGGCTTG GCGATGGGTT GCGGTGACCT GTTTTGGGTT GACGGCTTAT        60
     GGGTTTAGCC AGGAGAAGGC TACTCCGTTG ACGTTTGAGG TGGCTACGGT GCGGCTGACG       120
     AAGCCGGGGG AGCTCGATGG TTGGATCAAG GCTCTGCCGG GTGGGGCGGA GTATACGGCG       180
     CACAACATTC CGGTGAAGCT GATGATCAGC CTGATGTACA AGGTGCCGAT GCGGCAGATC       240
     AGTGGTGGCC CGGACTGGAT GGAGACGGAC AAGTATGACG TGGAGGCGAA GGCGGACAAG       300
     TCCTACAGCC TGGACGATCT TCATACGATG TACCGGGGCT TGCTGGCGGA GAGGTTTCAC       360
     CTGAAGGTGC GCAAGGAGAT TCATGAAGGG CCGGTCTATG CGCTGACGGT GGACAAGGGT       420
     GGCGTGAAGA TGAAGCCGGA CCTGAGCGAG CAAAGCTATG CGATTCCGAT TACCTACAGT       480
     GGGGAGGGCG CGGTGGGGAA TAGGGTGCCG ATGTCTTATC TGAGCTGGTG GCTCGGACAG       540
     CAGCTGCAGT CCGAGAGCAG GCCGGTGGTG GACGAGACGG GATTGAAGGA GAACTTCGAT       600
     TTCACGTTGA GCTTTACGCC GCCTCGGCTG GAGGGCACGG ACGGCGGTGC GGCAGAGAAG       660
     CCTTCGCTTT TCACCGCCGT CAAAGAGCAG CTTGGATTGA AGCTCGAGGC TCAGAAGGGA       720
     CCTGTGGAGT ACTACGTGAT TGAGCACATC GAGCGGCCGA GCGCAAATTA G                771
//

If you have problems or comments...

PBIL Back to PBIL home page