(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE41

ACIDO1_5.PE41        Location/Qualifiers
FT   CDS_pept        47772..48392
FT                   /locus_tag="AciX9_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_0458"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_0458 hypothetical protein"
FT                   /db_xref="GI:322433700"
FT                   /db_xref="GeneID:10202014"
FT                   /translation="MPALGLVWLLAMVPGVRYLLAYEHTAGSQGTAPRGWPKGMPQVGD
FT                   AALPTLVVALHPRCSCSQATLAELEEAAQGFGHPYNAVLLIYRPKGSDYEWQKVDLYRD
FT                   AQKALHARVMLDDDGQYSAAFGAETSGEVLYYSAAKGAAGRRLLFSGGVTGSRGMVGGN
FT                   DGIEALKSAFKLDREPEHAKTPVFGCGLFAALEPQAAEKRSRP"
FT                   /protein_id="YP_004215912.1"
     TTGCCTGCGC TGGGTTTGGT CTGGCTGCTG GCGATGGTGC CGGGGGTTCG GTACCTGCTG        60
     GCGTATGAAC ATACTGCCGG GAGCCAGGGC ACTGCGCCGC GCGGCTGGCC GAAGGGGATG       120
     CCTCAAGTTG GTGATGCGGC GCTGCCGACG CTGGTGGTTG CGCTGCATCC GCGGTGCTCG       180
     TGCTCGCAGG CGACGCTGGC GGAGCTTGAG GAGGCTGCGC AGGGGTTTGG ACATCCCTAT       240
     AACGCGGTGC TGCTGATTTA CCGGCCGAAG GGCTCGGACT ACGAGTGGCA GAAGGTGGAT       300
     CTCTACCGCG ACGCGCAGAA GGCGCTGCAT GCGCGGGTGA TGCTGGATGA TGACGGGCAG       360
     TATTCGGCTG CGTTTGGCGC AGAGACGTCC GGTGAAGTGC TGTACTATTC GGCGGCCAAG       420
     GGTGCAGCGG GACGCAGACT GCTGTTCAGC GGGGGTGTGA CGGGCTCGCG CGGGATGGTG       480
     GGGGGCAATG ACGGGATTGA GGCGCTGAAG AGTGCGTTCA AGCTGGACCG TGAGCCGGAG       540
     CACGCAAAGA CGCCGGTGTT TGGTTGTGGA TTGTTTGCAG CACTCGAGCC CCAGGCTGCA       600
     GAGAAGCGGA GTAGACCATG A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page