(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE42

ACIDO1_5.PE42        Location/Qualifiers
FT   CDS_pept        48389..50395
FT                   /locus_tag="AciX9_0042"
FT                   /gene_family="HOG000167947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   pca:Pcar_2937 signal transduction protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="GI:322433701"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:10202015"
FT                   /translation="MNPSILSSERVTSVNVAKEAERLFRSEHRLVCTRTDRLFAILMSL
FT                   QWPAAVAAALLISSRTWVGGTSSVHPHLIAAVYLGGLITVPPVLLAFFRPGERYTRHII
FT                   AACQMLMSGLLIHVSGGRIETHFHVFGSLAFLAFYLDWEVLATATLVTLVDHLAMGYYL
FT                   PASIFGTATASHWRLLEHVLWVVFFDIFLITSCVQGLKWLHAVARREADQELLLYQAYH
FT                   DALTGLGNRLQIQKLMGELLMPGSKEPRPFALMAIDLDRFKEVNDTLGHQVGDELLRQV
FT                   SQRLMAQIRKNDTLVRMGGDEFALVLDGCTSARVAESIAGRMVESLNKPFSLGDHTARI
FT                   GASIGICLHLDEGQDATDLFHHADLALYKVKNSGRNSFMVFDENMRAETLHQMSMEHRL
FT                   RSAVLENQMHLHYQPIVSTEGRLLGFEALLRWNDAVHGDVSPVDFIPLAEKTGLIIPLG
FT                   AWVLQQACSQAAQWHRTGNKLMKMSVNVSSIQLAHKDFVTTVLTALKETGLPAELLDLE
FT                   LTESALIQQHDSSYESLHLLRRFGVKLSIDDFGTGYSSLSYLRDLPVHTLKIDRAFVKD
FT                   IEISPESRTLVEGMIDMAHTLHLRVVAEGVENRKQMEILVEAGCDEIQGFHISKAVPAD
FT                   DARRFINVSHGEPEIKAMAGAAKVRGLAEVLAR"
FT                   /protein_id="YP_004215913.1"
     ATGAATCCAT CGATTCTCAG CTCGGAAAGA GTGACTTCAG TGAATGTTGC AAAAGAAGCG        60
     GAACGACTTT TTAGAAGCGA GCACCGGCTG GTCTGCACAA GGACGGATCG TCTGTTTGCG       120
     ATCCTGATGA GTCTGCAGTG GCCGGCCGCA GTGGCGGCCG CTCTGCTGAT ATCTTCACGC       180
     ACCTGGGTGG GCGGGACCAG CTCTGTGCAT CCGCACCTGA TCGCGGCGGT GTACCTGGGC       240
     GGACTGATCA CGGTTCCGCC GGTGCTGCTG GCGTTTTTCC GGCCGGGCGA GCGTTATACG       300
     CGGCATATCA TTGCCGCCTG CCAGATGTTG ATGTCTGGAC TGCTGATTCA TGTTTCGGGC       360
     GGGCGGATTG AGACGCACTT TCACGTGTTC GGATCGCTGG CGTTCCTGGC GTTCTACCTG       420
     GACTGGGAGG TGCTGGCGAC GGCAACGCTC GTCACGCTGG TGGACCACCT GGCGATGGGC       480
     TACTATCTGC CTGCTTCGAT CTTCGGGACC GCGACGGCCA GCCATTGGCG GTTGTTGGAG       540
     CATGTACTGT GGGTGGTGTT CTTTGACATC TTCCTGATCA CGAGCTGCGT ACAGGGATTG       600
     AAGTGGCTGC ATGCAGTGGC TCGGCGCGAA GCCGACCAGG AGCTACTGCT GTATCAGGCC       660
     TACCACGATG CCCTGACGGG GCTTGGAAAC CGGCTGCAGA TCCAGAAGCT AATGGGCGAA       720
     CTGCTGATGC CGGGCTCCAA GGAGCCGCGT CCCTTTGCGC TGATGGCGAT CGACCTGGAC       780
     CGCTTCAAGG AGGTCAACGA CACGCTGGGC CATCAGGTGG GCGACGAGCT GCTGCGGCAG       840
     GTGAGTCAAC GTCTGATGGC GCAGATCCGC AAGAACGATA CGCTGGTGCG CATGGGTGGC       900
     GATGAGTTCG CGCTGGTGCT GGATGGATGC ACGAGCGCGA GGGTGGCGGA AAGCATTGCG       960
     GGCCGGATGG TAGAGAGCCT GAACAAGCCG TTCTCGCTGG GCGATCACAC GGCACGCATC      1020
     GGCGCGAGCA TCGGGATCTG CCTGCATCTG GACGAGGGTC AGGATGCGAC CGACCTGTTC      1080
     CACCATGCGG ATTTGGCGCT GTACAAGGTG AAGAACAGCG GGCGCAACAG CTTCATGGTC      1140
     TTTGACGAGA ACATGCGTGC GGAGACGCTG CACCAGATGA GTATGGAGCA TCGCTTGCGG      1200
     AGCGCGGTGC TGGAGAACCA GATGCATCTG CACTACCAGC CGATCGTCAG CACAGAGGGC      1260
     AGGCTGCTGG GGTTTGAGGC GCTGCTGCGC TGGAACGACG CCGTCCACGG AGACGTTTCG      1320
     CCGGTGGACT TTATTCCGCT TGCGGAGAAG ACCGGCCTCA TCATTCCGCT GGGCGCGTGG      1380
     GTCCTGCAGC AGGCGTGCAG CCAGGCGGCG CAGTGGCACA GGACGGGCAA CAAGCTGATG      1440
     AAGATGTCGG TGAATGTATC GTCCATTCAA CTGGCGCACA AGGACTTTGT GACAACCGTG      1500
     CTGACGGCAC TGAAGGAGAC TGGGCTGCCG GCGGAGCTGC TGGACCTGGA GCTGACCGAG      1560
     AGCGCGCTGA TTCAGCAGCA TGACAGCAGC TACGAATCAT TGCATTTGCT ACGCCGGTTC      1620
     GGGGTGAAGC TTTCGATCGA CGACTTTGGG ACGGGCTATT CGTCGTTGAG TTATCTGCGC      1680
     GATCTGCCGG TGCATACGCT GAAGATCGAC CGGGCGTTTG TGAAGGATAT CGAGATCTCG      1740
     CCGGAGTCAC GCACGCTGGT GGAGGGCATG ATCGACATGG CGCATACCCT GCACCTGCGG      1800
     GTGGTCGCGG AGGGAGTGGA AAACCGGAAG CAGATGGAGA TCCTGGTGGA GGCGGGGTGC      1860
     GATGAGATCC AGGGCTTCCA CATCTCGAAG GCGGTTCCGG CGGATGACGC GCGGCGCTTT      1920
     ATCAATGTGA GTCACGGCGA GCCCGAGATC AAGGCCATGG CAGGAGCGGC CAAAGTGCGC      1980
     GGGCTGGCCG AGGTTCTGGC ACGCTAG                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page