(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE43

ACIDO1_5.PE43        Location/Qualifiers
FT   CDS_pept        50466..50993
FT                   /locus_tag="AciX9_0043"
FT                   /gene_family="HOG000020479" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   aca:ACP_0848 cupin domain protein"
FT                   /db_xref="GI:322433702"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:10202016"
FT                   /translation="MAEATAVPADDLQRYLKLAQPDGDVKLPHLGVVGDTYTLLLTGKD
FT                   TAGRLSLIDMHVPPGGGPPPHRHDFEETFIVLDGELSAIFRGQKMAVKAGETVHIPSNA
FT                   PHQFHNSSDKPVRMLCICSPAGQEEMFLEIGVPVATRTTAPPPLSEDEQKAFRAQAEAL
FT                   APKYKTELLAHA"
FT                   /protein_id="YP_004215914.1"
     ATGGCTGAGG CAACCGCAGT TCCGGCGGAC GATCTGCAAC GATATCTGAA GCTGGCGCAG        60
     CCTGATGGCG ATGTGAAGTT ACCCCATCTG GGCGTGGTGG GCGATACGTA CACGCTGCTG       120
     CTGACCGGCA AGGATACGGC TGGGCGGCTG AGCCTGATCG ATATGCATGT GCCGCCGGGT       180
     GGCGGGCCGC CGCCGCATCG GCATGACTTT GAGGAGACCT TCATCGTGCT GGACGGGGAG       240
     CTCTCCGCGA TCTTCCGTGG GCAGAAGATG GCCGTGAAGG CGGGGGAGAC AGTACATATT       300
     CCGTCGAATG CGCCGCACCA GTTTCATAAC AGTTCAGACA AGCCCGTGCG GATGCTCTGT       360
     ATCTGCTCGC CTGCGGGGCA GGAGGAGATG TTCCTGGAGA TCGGTGTGCC GGTTGCGACG       420
     CGGACGACTG CGCCACCGCC CTTGAGCGAG GACGAGCAGA AGGCGTTTCG CGCGCAGGCT       480
     GAGGCTTTGG CACCGAAGTA CAAGACGGAG CTTCTGGCGC ACGCATAA                    528
//

If you have problems or comments...

PBIL Back to PBIL home page