(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE44

ACIDO1_5.PE44        Location/Qualifiers
FT   CDS_pept        51033..51971
FT                   /locus_tag="AciX9_0044"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sus:Acid_4915 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:322433703"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:10202017"
FT                   /translation="MLKKIAGVMLMGVVSALAQTNAVRNTPRTILVHAHRGGRALRPEN
FT                   TIPSFQHGIDVGADVLELDLAVTKDGVLVVSHSPYLTYPVDTDVAKERVCDGPALPPGT
FT                   AIHTLTLAQLKQYDCGLHPLKRFPKQMAVPHTTIPTFDEVLELAPQGTFQFNVETKIYP
FT                   NHPELTPAPEAFVKMIDDAVKRRHLQARVILQSFDFRTLHAMRAIDPAIRLSALFEAKD
FT                   DGFTGIADQDKSFAHIAKVSGAEILSPDQTLVTPEAVATAHAMGRQVAPFTVNTSEGWQ
FT                   KMADAKVDAIISDDPVALLAWLRAQNPPLHP"
FT                   /protein_id="YP_004215915.1"
     ATGCTCAAGA AAATCGCTGG CGTGATGTTG ATGGGTGTGG TGAGTGCCTT GGCTCAGACG        60
     AACGCTGTAA GAAACACGCC TCGGACGATT CTGGTTCATG CTCATCGGGG TGGGCGTGCG       120
     CTCCGGCCGG AGAATACGAT TCCTTCGTTT CAGCATGGGA TAGACGTGGG CGCGGATGTG       180
     CTGGAGCTTG ATCTGGCGGT GACGAAAGAC GGTGTGCTGG TGGTGTCGCA CTCGCCTTAT       240
     CTGACGTACC CGGTGGACAC GGACGTTGCG AAGGAGCGGG TGTGCGATGG GCCGGCGCTG       300
     CCGCCCGGGA CCGCGATCCA TACACTGACG CTGGCGCAGT TGAAGCAGTA CGACTGCGGA       360
     CTCCATCCGC TGAAACGTTT TCCAAAGCAG ATGGCGGTGC CGCATACGAC GATTCCCACG       420
     TTTGACGAGG TGCTGGAGCT GGCGCCGCAG GGGACGTTTC AGTTCAACGT GGAGACGAAG       480
     ATCTATCCCA ACCATCCGGA GCTGACACCT GCCCCTGAGG CATTTGTGAA GATGATCGAC       540
     GATGCAGTGA AGCGGCGGCA TTTGCAGGCA AGGGTGATCC TGCAGAGCTT CGACTTCAGG       600
     ACGCTGCACG CGATGCGGGC GATTGATCCT GCCATTCGGC TGTCAGCGTT GTTCGAGGCG       660
     AAGGATGACG GCTTTACCGG GATTGCGGAT CAGGACAAGA GCTTCGCACA CATTGCGAAG       720
     GTCAGCGGCG CTGAGATCCT GAGCCCGGAT CAGACCCTGG TGACACCGGA GGCCGTTGCA       780
     ACGGCCCATG CGATGGGGCG GCAGGTCGCT CCGTTCACCG TGAACACGTC AGAGGGTTGG       840
     CAGAAGATGG CGGATGCAAA GGTTGATGCG ATCATCTCTG ACGATCCGGT TGCTCTGCTG       900
     GCGTGGCTGC GGGCGCAGAA CCCTCCGCTG CATCCTTAG                              939
//

If you have problems or comments...

PBIL Back to PBIL home page