(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE45

ACIDO1_5.PE45        Location/Qualifiers
FT   CDS_pept        complement(51989..52642)
FT                   /locus_tag="AciX9_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /codon_start="1"
FT                   /product="pentapeptide repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   clj:CLJU_c15620 hypothetical protein"
FT                   /db_xref="GI:322433704"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="GeneID:10202018"
FT                   /translation="MAPKPKSRQAPQIDHDILTEDFAAQLDSGAVHDALAADTTLPPFV
FT                   SPRGQSARLDRCLWRNVTLTAPNARGLRLYDTQIEGSDLANLDLTGGHLERVEITGTRL
FT                   TGATFTEAQLKSVLFRECKLDLAFFRMARLQHCVFERCNLTDADLYNADLTGTIFKDCD
FT                   LSRAELSHAKLIQADVRDCRLDGLRGTPADMAGLMISPDQAPQLITLFGVKVKW"
FT                   /protein_id="YP_004215916.1"
     atggcaccca agcccaaatc ccggcaagcc ccacagatcg accacgacat cctcaccgaa        60
     gacttcgccg cccaactaga ctccggcgcg gtccacgatg ccctcgccgc tgacaccacc       120
     ctcccgccct tcgtcagccc gcgcggtcag tccgcacgtc tggatcgatg cctgtggcgc       180
     aacgtcaccc tcaccgcccc caacgcgcgc ggcctgcgcc tctacgacac tcagatcgaa       240
     ggctccgacc tcgccaacct cgatctcacc ggcggccacc tcgagcgtgt cgagatcacc       300
     gggacccgcc tcaccggagc taccttcacc gaggcccagc tcaagagcgt cctcttccgt       360
     gagtgcaagc tcgacctggc cttcttccgc atggctcgcc tgcagcactg cgtctttgag       420
     cgctgcaacc tcaccgacgc ggacctctac aacgcggacc tgaccggcac catcttcaag       480
     gactgcgacc tcagccgcgc cgaactctcc cacgccaagc tcattcaggc ggatgtccgc       540
     gactgccgcc tcgacggcct gcgcggcacg cccgccgaca tggcgggtct catgatcagc       600
     cccgaccagg ctccacagct catcacgctc ttcggcgtga aggtgaagtg gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page