(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE46

ACIDO1_5.PE46        Location/Qualifiers
FT   CDS_pept        complement(52652..52978)
FT                   /locus_tag="AciX9_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dana_GF11791"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dan:Dana_GF11791 GF11791 gene product from
FT                   transcript GF11791-RA"
FT                   /db_xref="GI:322433705"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="GeneID:10202019"
FT                   /translation="MRPRLHCSRLGLERKNAINCDGLTLLLAVSMTSTGTYNFDDNFTV
FT                   FLDIFNNFNGQVFTVLQRKNAHRTYFGFVQPLRNFGTWHLPISIAVSTAMNRCQCLFQH
FT                   SHAM"
FT                   /protein_id="YP_004215917.1"
     atgcggccac ggctgcactg ctctcgcctg gggcttgaaa gaaagaacgc gatcaattgc        60
     gatggattga cgctcttgct ggctgtcagc atgacgtcga ctgggactta taacttcgac       120
     gataacttca cggtcttcct cgacatattc aataatttca acggtcaagt gttcaccgtt       180
     ctccagcgta agaatgccca ccgtacttat ttcggtttcg tccaaccatt gcggaatttc       240
     ggcacttggc atttgccaat cagcatagca gtcagcaccg cgatgaacag gtgccagtgt       300
     ttgtttcagc acagccatgc tatgtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page