(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE47

ACIDO1_5.PE47        Location/Qualifiers
FT   CDS_pept        53048..53449
FT                   /locus_tag="AciX9_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ESA_01683"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: esa:ESA_01683 hypothetical protein"
FT                   /db_xref="GI:322433706"
FT                   /db_xref="GeneID:10202020"
FT                   /translation="MTAGSLTLFILLANKPYGIQEASVVEYTLFEIFLTFAATRSLRRY
FT                   LFTCPAVRPQIPRLLWRHLGYVITLVIFQAVMLAARPNLSSWWNTPDKKGSTPFEIALF
FT                   FLCFGIGYAQVLGSRSILERAHQDFSTPG"
FT                   /protein_id="YP_004215918.1"
     ATGACCGCTG GCAGCCTGAC TCTCTTCATC CTCTTGGCAA ACAAGCCATA CGGGATTCAA        60
     GAGGCATCCG TGGTCGAGTA CACGCTTTTT GAAATCTTCC TCACCTTCGC TGCAACCCGC       120
     AGTCTCCGGC GCTACCTTTT TACTTGTCCA GCAGTTCGGC CGCAGATTCC GCGTCTCCTT       180
     TGGCGCCATT TGGGCTATGT GATCACGCTT GTAATCTTCC AGGCTGTTAT GTTGGCTGCT       240
     CGTCCGAACC TATCCAGTTG GTGGAACACC CCAGACAAAA AGGGCAGCAC TCCCTTCGAA       300
     ATTGCGCTTT TTTTTCTTTG CTTCGGTATC GGATACGCAC AGGTTCTTGG CAGCCGCTCT       360
     ATACTTGAGC GCGCTCATCA AGATTTCTCC ACGCCGGGTT AG                          402
//

If you have problems or comments...

PBIL Back to PBIL home page