(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE48

ACIDO1_5.PE48        Location/Qualifiers
FT   CDS_pept        53602..55092
FT                   /locus_tag="AciX9_0048"
FT                   /gene_family="HOG000261989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01229"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 39"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 39; KEGG:
FT                   aca:ACP_1578 glycosyl hydrolase, family 39"
FT                   /db_xref="GI:322433707"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="InterPro:IPR000514"
FT                   /db_xref="GeneID:10202021"
FT                   /translation="MRQFWLKGLLLGAAACATGVGHAQETVVVDAHAAAKPFPHFWEQM
FT                   FGSGRAILTLRESYRDDVKAVKKVADFKYVRFHAIFHDEVGVYNEDEHGNPVYNFAYVD
FT                   AIYDGLLKNGVKPMVEISFMPKKLAFPDALHPFWYKQNVSPPKSMEKWDGLIHAFTQHL
FT                   IDRYGVDEVASWYFEVWNEPNIDFWNGIPRLESYFELYDHTARDIKAVNPRLRVGGPAT
FT                   AAAQWVPEFLAHVAENHVPIDFVTTHGYGDDTVENMFNTHEKIAVDDRVGRAVAKVRGE
FT                   INKSPLPKLPLYWTEWNVPGLMQSRDTTYVGPALANTVREADGNVDMLSFWTFSDVFEE
FT                   GGPTTTPFRGDFGLRAFDGINKPSYYAYGLLHELGPQRIANKSDNVIVTKDADGGLALV
FT                   AWNLVDPDQHGSDRTMELEFKGVAKDAKVTIERVDNEHGNVLPKWAAMGKPLNPTPTQA
FT                   TQLNEETAMPAPEQTTLVNGRLKLELEQNALVLVKVAR"
FT                   /protein_id="YP_004215919.1"
     GTGCGTCAGT TCTGGTTGAA GGGTTTGCTG CTGGGTGCGG CTGCGTGTGC GACGGGTGTG        60
     GGCCACGCGC AGGAGACTGT CGTGGTCGAT GCTCACGCGG CGGCGAAGCC GTTTCCGCAC       120
     TTCTGGGAGC AGATGTTCGG CTCCGGTCGC GCGATCCTCA CGCTGCGGGA GAGCTACCGC       180
     GATGACGTGA AGGCCGTGAA GAAGGTGGCG GACTTCAAGT ACGTGCGCTT CCACGCCATC       240
     TTTCATGACG AGGTGGGGGT CTATAACGAG GATGAACATG GCAATCCCGT CTACAACTTT       300
     GCGTATGTGG ACGCGATCTA CGACGGGCTG CTGAAGAACG GGGTGAAGCC GATGGTGGAG       360
     ATCAGCTTCA TGCCGAAGAA GCTGGCCTTC CCGGATGCGC TGCACCCGTT CTGGTACAAG       420
     CAGAACGTCT CGCCGCCCAA GAGCATGGAG AAGTGGGACG GCCTCATCCA CGCCTTCACC       480
     CAACACCTGA TCGATCGTTA TGGCGTGGAT GAGGTGGCGA GCTGGTACTT CGAGGTGTGG       540
     AACGAGCCGA ACATCGACTT CTGGAACGGC ATCCCGCGGC TGGAGTCCTA CTTTGAGCTG       600
     TATGACCACA CGGCTCGCGA TATCAAGGCC GTGAATCCGC GTCTGCGCGT AGGCGGCCCC       660
     GCAACCGCAG CCGCACAGTG GGTGCCGGAG TTCCTGGCAC ATGTGGCGGA GAATCATGTT       720
     CCCATCGACT TCGTCACCAC GCATGGATAC GGTGACGATA CCGTCGAGAA CATGTTCAAC       780
     ACGCACGAGA AGATTGCCGT GGATGACCGC GTAGGCCGTG CCGTGGCGAA GGTGCGCGGC       840
     GAGATCAACA AGTCGCCTCT GCCTAAGCTG CCGCTCTATT GGACGGAGTG GAATGTGCCC       900
     GGGCTGATGC AATCTCGGGA CACGACGTAT GTTGGCCCGG CGCTGGCCAA CACGGTCCGC       960
     GAGGCCGACG GTAACGTCGA TATGCTCTCC TTCTGGACCT TCTCCGATGT CTTTGAAGAG      1020
     GGCGGTCCGA CGACGACTCC GTTTCGCGGA GACTTCGGGT TGCGCGCCTT CGACGGCATC      1080
     AACAAGCCAA GCTACTACGC CTACGGTCTG CTGCATGAAC TTGGGCCACA ACGGATCGCG      1140
     AACAAGTCAG ACAACGTAAT TGTGACGAAG GATGCGGACG GCGGCCTGGC ACTGGTGGCA      1200
     TGGAACCTGG TCGACCCGGA TCAGCATGGC TCGGACCGCA CGATGGAACT CGAGTTCAAA      1260
     GGCGTGGCGA AGGACGCGAA GGTGACGATC GAGCGCGTGG ACAACGAACA TGGCAACGTA      1320
     CTGCCCAAGT GGGCTGCGAT GGGCAAGCCG CTCAACCCAA CGCCCACGCA GGCAACGCAG      1380
     TTGAACGAAG AAACGGCCAT GCCCGCGCCA GAGCAGACAA CACTGGTGAA TGGCCGCCTG      1440
     AAGTTGGAGC TGGAGCAGAA CGCGCTGGTG CTGGTGAAGG TGGCTCGGTA G               1491
//

If you have problems or comments...

PBIL Back to PBIL home page