(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE49

ACIDO1_5.PE49        Location/Qualifiers
FT   CDS_pept        complement(55098..56762)
FT                   /locus_tag="AciX9_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tpau_4105"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tpr:Tpau_4105 putative mannosyltransferase"
FT                   /db_xref="GI:322433708"
FT                   /db_xref="GeneID:10202022"
FT                   /translation="MLALSFAVPLLVLCAYWFFFIRADYYPSRDEFSLLVASTKMFHPA
FT                   ISTWFLEGYSRYFLSYPGLSHPATDFIRPGANLAYYVNSLLFGANWSCYLLLSYFIQAG
FT                   LVCITVKLALEALKLPRSLAVFAGVAVLLAPSFGWEQIYIPSFTIDLLGAFFVMLALHE
FT                   LWRSRNVTAWLLLAAAIFTKETTLFAPVMTALAVWLPIGKPSSIGRRFTASILWLTPIF
FT                   VWMLLRHFAFHGGAGIYVFQNMALKGTLMNVLHGFLAWPFGTRSMQQSVRYRSLFFMLN
FT                   AAFWAAVFFAVVRWRRGKASSEASSEITCMPALLLFSIGAMAMPVLLNLPQRFGASLYP
FT                   LLFLTLATIAHAASDLTIRRLAVGALAASTLVAIYQKATDPLTLKESRAEWTLSRNYIQ
FT                   SIHAVRSPYLLLVDDSSGGFAAPDLVARFADFHGTLMRSNNIEGLMLDHCAGQPTVTKT
FT                   SADEGHLALTSTLTPPCGYYAFDSLSPRELERGTDGLVTHPNDRVTLRIVPPALQPLPP
FT                   SATPEMWGNLTVSLTSPVKDTVVLVPDLNTLTYHQLK"
FT                   /protein_id="YP_004215920.1"
     atgctcgccc tcagctttgc cgtgccgctg ctggtcttgt gtgcctactg gttcttcttc        60
     atccgcgcgg actactaccc cagccgcgat gagttctcgc tgctcgtcgc ctcgacgaag       120
     atgtttcatc cggctatttc gacctggttc ctcgaaggct atagccgcta cttcctctcg       180
     tacccagggc tctcgcatcc tgccaccgac ttcatccgcc caggcgccaa cctggcttac       240
     tacgtcaact cgctactctt tggtgcgaac tggtcctgct atctgctgct cagttacttc       300
     atccaggccg ggctggtctg catcacggtc aagctcgcgc tcgaagccct gaagcttcca       360
     cgctcgctgg ccgtgttcgc tggtgtggcc gtgctgctgg caccgtcctt cggttgggag       420
     cagatctaca tcccgtcgtt caccatcgat ctcctcggtg cgttcttcgt catgctcgcc       480
     ctgcatgaac tctggcgcag cagaaacgtt accgcatggc tcctgctcgc tgccgccatc       540
     ttcaccaagg agaccacgct cttcgccccg gtcatgaccg cgctcgccgt ctggctgccc       600
     ataggcaagc cttcttctat cggcaggcgc ttcaccgcct cgatcctctg gctcactccg       660
     atctttgtgt ggatgctgct gcggcacttc gccttccacg gtggagcagg catctatgtc       720
     ttccagaaca tggcgctcaa gggcaccctg atgaacgtgc tgcatggctt cctcgcatgg       780
     ccctttggca cccgcagcat gcagcaaagc gtccgttatc gctctctctt cttcatgctc       840
     aacgcggcct tctgggcggc tgtattcttt gctgttgtcc gctggcggcg cgggaaggct       900
     tcatccgaag catcgtcaga gataacttgt atgcctgcgt tgttgctctt tagcatcggc       960
     gcaatggcga tgccagttct gctcaacctg ccgcaacgct tcggcgcgtc actctatccg      1020
     ctactcttcc tgacgctggc caccatcgcc cacgcagcaa gcgatctaac catccgcaga      1080
     ctagctgtcg gagccctcgc cgcatccact ctcgtcgcca tctatcagaa ggcgaccgac      1140
     cctctcactc tcaaggaatc ccgcgccgag tggacgctct cccgcaacta catccagtcc      1200
     atccacgccg tacgctcccc atacctgctg ctcgtagacg actccagcgg gggctttgcc      1260
     gcacctgatc tcgtagctcg cttcgcagac ttccacggca cgcttatgcg tagcaataac      1320
     atcgaaggct tgatgctgga tcattgcgct ggccaaccca ccgtcacgaa gacgtcagcc      1380
     gatgaaggcc acctggccct gacgtcaacc cttacgccgc cctgcggtta ctacgccttc      1440
     gacagcctct cgccccgcga gcttgaacgt ggcactgacg gcctcgtcac gcacccgaac      1500
     gatcgcgtca cattgcgcat cgtcccgcct gcacttcagc cgttgccgcc gtcagcaacg      1560
     ccggagatgt gggggaacct gaccgtatcg cttaccagcc ccgtcaaaga cacggttgtc      1620
     ttagtccctg acctcaacac cctcacctac catcaactca aataa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page