(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE50

ACIDO1_5.PE50        Location/Qualifiers
FT   CDS_pept        56918..57145
FT                   /locus_tag="AciX9_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:FB2170_02290"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fbc:FB2170_02290 hypothetical protein"
FT                   /db_xref="GI:322433709"
FT                   /db_xref="GeneID:10202023"
FT                   /translation="MRLIFRSLLAAALCLLAVPVISAQTIRVSYPDARSAKPLDGRLLL
FT                   LLSNDPSEDPRMQINDTQKSQQVFGMTVDG"
FT                   /protein_id="YP_004215921.1"
     ATGCGCCTGA TCTTTCGTTC TCTCCTTGCG GCAGCCTTAT GCCTGCTTGC CGTGCCGGTG        60
     ATCTCAGCCC AGACCATCCG GGTCAGCTAC CCGGACGCAC GTTCGGCCAA GCCACTGGAC       120
     GGGCGTTTGC TGCTTCTGCT CTCCAACGAT CCCAGCGAAG ACCCGCGCAT GCAGATCAAC       180
     GACACGCAGA AGTCGCAGCA GGTCTTTGGA ATGACGGTGG ATGGCTGA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page