(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE51

ACIDO1_5.PE51        Location/Qualifiers
FT   CDS_pept        57160..58647
FT                   /locus_tag="AciX9_0051"
FT                   /gene_family="HOG000252249" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Slin_1343"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sli:Slin_1343 hypothetical protein"
FT                   /db_xref="GI:322433710"
FT                   /db_xref="GeneID:10202024"
FT                   /translation="MMIGENAQGYPRASLKDVPPGEYTVQAVLNVYETFQRGDGKMVKL
FT                   APDRGEGQHWNLAPGNLMSKPRKVKIGPGTMPITVSLDQVIPPNVPEKDTKYIRHIKVQ
FT                   SALLTRFWGRPMFLSAVVLVPEGFDTHTEAHYPLVIFHDHFVSGFSDFRETPPDAKLKA
FT                   DYSERFHLAGYNRIQQEEAYKNYKDWVAPNKPRMLIIKIQHANAYYDDSYAVNSENLGP
FT                   YGDAIETELIPAVEKEFRALGQGWARFVYGGSTGGWESLAVQMFYPEHYNGAFVACPDP
FT                   VDFHAFMTADLYKQDNLFYEQGANKRVEQPAMRNYLGQTLISMRDNVAYEAALGDSARS
FT                   GDQFDIWQAVYSPVGADGYPRPIFNKTTGTIDHTTAEYWRQHYDLNAILQRDWTKLGPK
FT                   LQGKIHLYVGSDDTYFLNNAVYLMEDFLKETGTPGHGVAYDGEVKYGPRAEHCWNGDPE
FT                   KPNWYSRLHYNQMYVPMILDRIAKTAPAGADVTSWKY"
FT                   /protein_id="YP_004215922.1"
     ATGATGATCG GTGAGAATGC GCAGGGCTAT CCAAGGGCCT CGCTCAAGGA TGTGCCGCCG        60
     GGTGAGTACA CCGTACAGGC GGTGCTCAAC GTGTACGAAA CCTTCCAGCG CGGCGACGGC       120
     AAGATGGTCA AACTCGCACC GGATCGCGGC GAAGGCCAGC ACTGGAATCT CGCGCCAGGA       180
     AATCTGATGT CGAAGCCACG CAAGGTGAAG ATCGGCCCTG GCACGATGCC GATTACGGTT       240
     TCGCTGGATC AGGTGATTCC GCCAAATGTG CCTGAGAAGG ATACAAAATA CATCCGCCAC       300
     ATCAAGGTGC AGAGTGCGTT GCTGACAAGG TTTTGGGGCC GGCCCATGTT TCTTTCGGCG       360
     GTGGTGCTGG TGCCCGAGGG CTTCGACACC CATACGGAGG CGCACTATCC GCTGGTCATC       420
     TTCCATGACC ACTTCGTCAG CGGCTTCAGT GACTTTCGCG AGACGCCTCC GGATGCGAAG       480
     TTGAAGGCGG ATTATTCTGA GCGCTTCCAC CTGGCGGGTT ACAACCGCAT CCAGCAGGAG       540
     GAGGCGTACA AGAACTACAA GGACTGGGTC GCACCCAACA AACCTCGCAT GTTGATCATC       600
     AAGATCCAGC ACGCCAACGC GTACTATGAC GATTCCTATG CGGTGAACTC GGAGAACCTG       660
     GGACCGTATG GCGATGCCAT TGAGACGGAG CTGATCCCAG CGGTGGAGAA GGAGTTTCGT       720
     GCGCTCGGTC AGGGCTGGGC GCGCTTTGTG TATGGCGGCT CGACGGGTGG GTGGGAGTCT       780
     CTGGCCGTGC AGATGTTTTA TCCAGAGCAC TATAATGGTG CGTTCGTCGC ATGCCCTGAT       840
     CCGGTCGACT TTCATGCGTT CATGACGGCC GATCTCTACA AGCAGGACAA TCTCTTTTAC       900
     GAGCAGGGTG CGAACAAGCG CGTCGAGCAG CCCGCCATGC GCAACTACCT CGGCCAGACG       960
     CTGATCTCGA TGCGCGACAA CGTGGCGTAT GAAGCAGCCC TGGGCGATAG CGCCCGTTCA      1020
     GGCGATCAGT TCGACATCTG GCAGGCGGTG TATTCTCCGG TCGGCGCAGA TGGATATCCC      1080
     AGGCCGATCT TCAACAAGAC CACTGGCACC ATCGACCACA CCACGGCCGA GTACTGGCGT      1140
     CAGCACTATG ATCTCAACGC CATCCTGCAA CGCGACTGGA CGAAGCTCGG CCCGAAACTG      1200
     CAGGGCAAGA TCCACCTGTA TGTCGGGTCT GACGATACGT ACTTCCTGAA CAACGCCGTG      1260
     TACCTGATGG AAGACTTCCT GAAGGAGACC GGCACGCCCG GCCACGGAGT CGCGTATGAC      1320
     GGCGAGGTCA AGTACGGCCC GCGCGCGGAG CACTGCTGGA ACGGCGATCC AGAGAAGCCG      1380
     AACTGGTACT CGCGCCTGCA CTACAACCAG ATGTATGTGC CCATGATCCT GGATCGCATC      1440
     GCCAAGACTG CGCCGGCCGG AGCGGATGTG ACGAGCTGGA AGTACTAA                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page