(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE52

ACIDO1_5.PE52        Location/Qualifiers
FT   CDS_pept        complement(58651..59421)
FT                   /locus_tag="AciX9_0052"
FT                   /gene_family="HOG000017142" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /codon_start="1"
FT                   /product="glutamine cyclotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   cak:Caul_1498 glutamine cyclotransferase"
FT                   /db_xref="GI:322433711"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="GeneID:10202025"
FT                   /translation="MFARCFSLALVMFLSTLSAGCQSAPVQSYKVVRTYPHSTASYTEG
FT                   FFYLNGLFYEGTGLTGHSQLLVVKPETGKPVQQLDLPPELFGEGIVDWGPNLYEWTWKS
FT                   HTCFVYDRATLHKIGQLSYDGEGWGMTRDEHNLITSDGSTRLSFRDPASFKVVRQIAVK
FT                   DGAEAVSQLNELEYIHGEIYANVWHSDRIARISPQDGHVIAWIDLTGLLPADQRVDAES
FT                   VLNGIAYDAQHDRLFVTGKQWPKIFEIKALPKTK"
FT                   /protein_id="YP_004215923.1"
     atgttcgctc gctgcttttc gcttgccctt gtcatgttcc tttcgactct ctccgctgga        60
     tgccagtctg cgccggttca aagctataag gtcgtccgca cgtacccgca ctccaccgcc       120
     agctatacgg aaggcttctt ttacctgaac ggcctgttct atgaaggcac cgggctgacg       180
     ggccactcgc agcttctggt ggtgaagcct gagaccggca agcctgtgca gcagcttgac       240
     ctgccgcctg agctctttgg cgaaggcatc gtggactggg ggccgaacct ctacgagtgg       300
     acctggaaat cgcacacctg cttcgtctac gaccgcgcca cgttgcacaa gatcgggcag       360
     ctctcatacg acggagaagg ctggggcatg acgcgcgacg agcacaacct catcacctca       420
     gacgggagca cgcggctgag ctttcgcgat cctgcgagct tcaaggtcgt gcgccagatc       480
     gcggtgaagg atggtgcgga ggcggtcagc caactcaacg agctcgagta cattcacggc       540
     gagatctatg ccaacgtctg gcactcggat cggattgcac gcatctcgcc acaggacggg       600
     catgtgattg cttggatcga cctgaccggc ctgctgccgg cggaccaacg cgtagatgca       660
     gagtccgtgc tgaacggcat cgcctacgac gcgcagcatg atcggctatt cgtcaccggt       720
     aagcagtggc cgaagatctt cgagatcaaa gccttgccga agacaaagta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page