(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE6

ACIDO1_5.PE6         Location/Qualifiers
FT   CDS_pept        6913..7374
FT                   /locus_tag="AciX9_0006"
FT                   /gene_family="HOG000124209" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Acid345_3568"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_3568 hypothetical protein"
FT                   /db_xref="GI:322433665"
FT                   /db_xref="GeneID:10201979"
FT                   /translation="MRLGLGAGLLMAGGLLQGAAAQAVPQSITGRWRVERILPTHNVGC
FT                   WDAERAKTLVGSTLRYEQGRMTWQGGTVEVAEALSRTLSRRKYQDEYSVDLAELGIKAA
FT                   EVVEIDLQHEDADVTGATTEVPGDTVVMAGPGRIVVSACGVYFLAVRAR"
FT                   /protein_id="YP_004215877.1"
     ATGCGTCTGG GCCTTGGGGC CGGATTGTTG ATGGCAGGTG GACTGTTGCA GGGAGCGGCG        60
     GCGCAGGCTG TGCCGCAATC GATCACGGGC CGGTGGCGGG TGGAGAGGAT TCTGCCGACG       120
     CACAATGTGG GTTGCTGGGA TGCGGAACGG GCCAAGACGC TGGTGGGGTC GACGCTGCGG       180
     TATGAGCAGG GGCGGATGAC GTGGCAGGGC GGGACGGTCG AGGTGGCGGA GGCGCTCTCG       240
     CGTACGCTGA GCCGGCGGAA GTACCAGGAC GAGTACAGCG TGGACCTGGC GGAGCTTGGG       300
     ATCAAGGCGG CTGAGGTGGT GGAGATCGAC CTGCAGCATG AGGATGCGGA TGTGACCGGC       360
     GCGACGACTG AGGTTCCGGG CGATACGGTG GTGATGGCTG GGCCGGGGCG GATCGTGGTG       420
     AGCGCGTGCG GAGTTTACTT TCTTGCGGTG CGGGCGCGAT GA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page