(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE8

ACIDO1_5.PE8         Location/Qualifiers
FT   CDS_pept        7923..8957
FT                   /locus_tag="AciX9_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Srot_2219"
FT                   /codon_start="1"
FT                   /product="phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: srt:Srot_2219
FT                   phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthase-like protein"
FT                   /db_xref="GI:322433667"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:10201981"
FT                   /translation="MRSGLRVLGWMLIGVLAASAAGQAGTHSRHAGRVDTVTSGTRVLY
FT                   TFPQSNNSATPLYALVNGSLKTIDMTMYELVDTVFSADLVAACKRGVKVRVILDQNLEK
FT                   SSNTAAYNQLNKTTNCSAAWANPAFQATHQKSMIVDGTKLAIITLNLTTRYYTTSRDFA
FT                   LVETDAADIAAVEATFNADFKSTTSFAYQPGKGTDLIWSPTTATADLLGIINGATKTLL
FT                   VENEEMGAANVVSALEAACKRGVAVHVAMTNLTAYKTEFAALKAAGCGVHLYASTATGL
FT                   YIHAKVLVADYGLSTQMVYVGSINFSIPSMTDNRELGLYVSDATIVKALQTQVTTDYAG
FT                   APAL"
FT                   /protein_id="YP_004215879.1"
     ATGCGTTCTG GATTGCGAGT GCTGGGCTGG ATGCTGATCG GTGTACTGGC AGCGAGTGCC        60
     GCGGGTCAGG CCGGGACTCA TTCACGGCAT GCGGGCCGGG TGGATACTGT GACCTCCGGG       120
     ACGCGGGTGC TTTATACGTT TCCGCAGTCG AATAACAGCG CCACGCCGCT CTATGCGCTG       180
     GTGAATGGAT CGTTGAAGAC GATCGACATG ACGATGTACG AATTGGTGGA CACGGTGTTC       240
     TCCGCGGACC TGGTGGCGGC GTGCAAGCGC GGCGTGAAGG TTCGGGTGAT CCTGGATCAG       300
     AATCTTGAGA AGTCCAGCAA TACGGCGGCC TACAACCAGT TGAACAAGAC GACGAACTGC       360
     AGCGCGGCGT GGGCGAACCC GGCATTCCAG GCGACGCACC AGAAGAGCAT GATCGTGGAT       420
     GGAACGAAGC TGGCGATCAT AACGCTGAAC CTGACGACCC GGTATTACAC GACGTCGCGG       480
     GACTTTGCGC TGGTGGAGAC GGATGCGGCG GATATCGCGG CGGTGGAGGC TACGTTCAAT       540
     GCGGACTTCA AGTCGACGAC GTCATTTGCG TATCAGCCGG GCAAGGGGAC GGATCTGATC       600
     TGGAGCCCGA CGACGGCGAC GGCGGATCTG CTGGGAATCA TCAACGGTGC GACCAAGACA       660
     CTGCTGGTGG AGAACGAAGA GATGGGCGCG GCGAACGTGG TGAGCGCGCT GGAGGCGGCG       720
     TGCAAGCGCG GGGTTGCGGT ACATGTCGCC ATGACAAACC TGACTGCCTA CAAGACGGAG       780
     TTTGCGGCGC TGAAGGCGGC TGGATGCGGA GTTCACCTGT ACGCGAGTAC GGCGACGGGG       840
     CTCTACATCC ATGCCAAGGT GCTGGTGGCA GACTATGGTC TGAGCACGCA GATGGTTTAC       900
     GTGGGCTCGA TCAACTTCTC GATTCCCTCC ATGACGGATA ACCGGGAGCT GGGTTTGTAT       960
     GTTTCCGATG CAACGATCGT CAAGGCGTTG CAGACGCAGG TCACGACGGA CTACGCCGGG      1020
     GCACCTGCGC TTTAG                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page