(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIDO1_5.PE9

ACIDO1_5.PE9         Location/Qualifiers
FT   CDS_pept        complement(8954..9523)
FT                   /locus_tag="AciX9_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /codon_start="1"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   rsl:RPSI07_3238 conserved hypothethical protein"
FT                   /db_xref="GI:322433668"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="GeneID:10201982"
FT                   /translation="MRMSSQAQTPDPTYDAQPSSPPTIRWPGLHQPSDAAIFASNEIVI
FT                   PAPIEAIWPWLIRAELWPTWYPYSANIHFISTSGPDLRDRTRFRWSKFGVPITSKVREF
FT                   EPLTRLAYDIHGIGVLAYQAWLLTPLPDGTTHVLTQEVQTGWLARIGKRIMPHRLEDKH
FT                   QHWLEALSVKAQSGPPAQPRPFLKES"
FT                   /protein_id="YP_004215880.1"
     atgcgcatga gcagccaagc acagacgccc gatccgacct acgacgccca gccgagctct        60
     ccacccacca tccgctggcc cggtctccac caaccctcag atgcggccat cttcgcctcc       120
     aatgagatcg tcatccccgc acccattgag gccatctggc cctggctcat ccgcgccgag       180
     ctttggccca cctggtaccc ctactccgcc aacatccact tcatctccac ctccggcccg       240
     gacctgcgcg accgcacccg cttccgctgg agcaagttcg gcgtgcccat cacctcaaag       300
     gtccgcgagt tcgagcccct cacccgcctc gcctatgaca ttcacggcat aggcgtcctg       360
     gcataccagg cctggctcct gacccccctg cccgacggca ccacccacgt cctcacgcaa       420
     gaggtccaga ccggctggct cgcccgcatc ggcaagcgca tcatgcccca tcgcctggaa       480
     gacaagcacc agcactggct ggaagccctc agcgtcaaag cccagtccgg cccacccgcc       540
     cagcccaggc ctttcctcaa ggaaagctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page