(data stored in ACNUC8465 zone)

HOGENOMDNA: ACIF5_1

ID   ACIF5_1; SV 1; empty ; DNA; empty ; PRO; 2885038 BP.
XX
AC   NC_011206;
XX
PR   Project: 58613;
XX
DE   Acidithiobacillus ferrooxidans ATCC 53993 chromosome, complete genome.
XX
OS   Acidithiobacillus ferrooxidans ATCC 53993
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Acidithiobacillales;
OC   Acidithiobacillaceae; Acidithiobacillus.
XX
RN   [1]
RP   1-2885038
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Lykidis,A. and Borole,A.P.;
RT   "Complete sequence of Acidithiobacillus ferrooxidans ATCC 53993";
RL   Unpublished
XX
RN   [2]
RP   1-2885038
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (07-SEP-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2885038
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Lykidis,A. and Borole,A.P.;
RT   "Direct Submission";
RL   Submitted (12-AUG-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001132.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002947
CC   Source DNA available from Abhijeet P. Borole (borolea@ornl.gov)
CC   Bacteria available from ATCC: ATCC 53993
CC   Contacts: Abhijeet P. Borole (borolea@ornl.gov)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2885038
FT                   /strain="ATCC 53993"
FT                   /mol_type="genomic DNA"
FT                   /organism="Acidithiobacillus ferrooxidans ATCC 53993"
FT                   /db_xref="taxon:380394"
FT                   /culture_collection="ATCC:53993"
FT   gene            252..1610
FT                   /db_xref="GeneID:6878909"
FT                   /locus_tag="Lferr_0001"
FT   CDS_pept        252..1610
FT                   /locus_tag="Lferr_0001"
FT                   /gene_family="HOG000235660" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: hha:Hhal_1227 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="GI:198282149"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:6878909"
FT                   /translation="MSSHPAPSALHNGDALWAALCVQLQEQTTAQQFNTWLRPLRGELH
FT                   GNELRLFAPNTFVMEWVRERLIDLLEAVLAELAPGMLLRLELSPEQGLAPVPAGTATPS
FT                   APSIIEPRNGNRLNPGFSFQSYVEGKSNQLAVAAARQVAQNPGKSYNPLYIYGGVGLGK
FT                   THLMQAVGNAILQRNADAKVLYVSSEGFIMDMVRSLQHNTINDFKQRYRKLDALLIDDI
FT                   QFFAGKDRTQEEFFHTFNALFDGGRQIIITCDRYPKEVDRLEERLQSRFGWGLTVAIQP
FT                   HDLETRMAIVLCKAEESGVDLPEEVAFFIAEKIRSHVRELEGALRRVVAHVNFTHKPYN
FT                   LDTAREALRDLIDVQKRMVSLDNIQKVVAEYFHIRGSDMQSKRRSRNIARPRQVAMCLT
FT                   KELTNHSLPEIGEAFGGRDHTTVLHACRQIEKLRLEETQMDEDYRNLLRILGA"
FT                   /protein_id="YP_002218470.1"
FT   misc_feature    285..1601
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:178902"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    687..1076
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    720..743
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    order(723..746,909..911,1008..1010)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    897..914
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    1047..1049
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    1332..1601
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Lferr_0001"
FT   misc_feature    order(1401..1403,1425..1430,1449..1451,1467..1475,
FT                   1500..1514,1521..1523,1530..1535)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Lferr_0001"
FT   gene            1894..2991
FT                   /db_xref="GeneID:6875951"
FT                   /locus_tag="Lferr_0002"
FT   CDS_pept        1894..2991
FT                   /locus_tag="Lferr_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pst:PSPTO_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="GI:198282150"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:6875951"
FT                   /translation="MKITIDREDLLPILANMANIADRRPVQPILAHVLIEAAGQHCRFV
FT                   ATDLEVQLSADLDHPVDAPGTCAVPARKLYDICRALPEHTPIEFHKDGEKLLLKAAKSR
FT                   FTLHILPADQFPYLSTHSSLCQGNGNAKTFREALAVVANTMAQNDARLFLNGVLIEVEG
FT                   QELRLVATDGHRLAMMTLPFASSLESGSYQAILPRKAVLELLRILDDGDIVLEMSDASF
FT                   LLNDGTQQFACKLIDAKYPDYRRVIPQGHPRFAILDRQAFKSALQQSDVLVSDRNPTTH
FT                   LHLENDQMTLRSRNEEQEEGEIQIPVEYQGDTLDIAFNSRYLTDTTQIFPQESLRMRVK
FT                   DSDSSAVFTPVDSNNPLYIIMPVRL"
FT                   /transl_table="11"
FT                   /protein_id="YP_002218471.1"
FT   misc_feature    1894..2988
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:180180"
FT                   /locus_tag="Lferr_0002"
FT   misc_feature    1894..2985
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Lferr_0002"
FT   misc_feature    order(1963..1965,2107..2109,2128..2130,2488..2490)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Lferr_0002"
FT   misc_feature    order(2110..2112,2119..2121,2197..2199,2203..2205,
FT                   2704..2706,2797..2802)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Lferr_0002"
FT   misc_feature    order(2404..2406,2410..2421,2848..2850,2974..2985)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Lferr_0002"
FT   misc_feature    order(2404..2406,2410..2415,2629..2631,2734..2736,
FT                   2773..2778,2857..2859,2974..2985)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Lferr_0002"
FT   gene            2993..4045
FT                   /db_xref="GeneID:6875952"
FT                   /locus_tag="Lferr_0003"
FT   CDS_pept        2993..4045
FT                   /locus_tag="Lferr_0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: aeh:Mlg_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="GI:198282151"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:6875952"
FT                   /translation="MPLEALHIQSVRCIETLDLKTDRQWNWLIGANGAGKSSVLEAIHV
FT                   LGTGQTWRHGSRHVLREGDDAYLVSAHLSGHFLALRRRGEEREIRYDGEPLGSAWLLLD
FT                   ILPLQSLHEDNSHFVSGTAEGRRRVLDWGIYYADRYYGTVFRQYRRALQQRNAWLKSDH
FT                   GRQPWDDGVIVAGEDIQQRRQAHLAAVQLEVVTLWERWSGSLSGLSLHLHSGWKEGMAL
FT                   GDCLLRDHEQDREAGYTHSGPHRANLAFRVRGKPAPDILSRGQLRVLGLAYRLAQVKIL
FT                   KQAGLPLPTILIDDFAAELDASARDWWVNELDLLGVQIFAAVTTARQIPATVGGSHFCL
FT                   AAGQLEKETA"
FT                   /protein_id="YP_002218472.1"
FT   misc_feature    2993..4030
FT                   /note="recombination protein F; Reviewed; Region: recF;
FT                   PRK00064"
FT                   /db_xref="CDD:178835"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    2999..>3481
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3080..3103
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    order(3089..3094,3098..3106,3329..3331)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3320..3331
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    <3713..4030
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3773..3802
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3860..3877
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3884..3895
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   misc_feature    3953..3973
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Lferr_0003"
FT   gene            4042..6447
FT                   /db_xref="GeneID:6875953"
FT                   /locus_tag="Lferr_0004"
FT   CDS_pept        4042..6447
FT                   /locus_tag="Lferr_0004"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: lpc:LPC_0004 DNA gyrase, subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="GI:198282152"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR011558"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:6875953"
FT                   /translation="MMMETYDSSSIQVLKGLEAVRKRPGMYIGDTDDGSGLHHMVFEVV
FT                   DNAIDEALGGYCDTIIVTIHEDESVSISDNGRGIPVDMHAGEGRSAAEVIMTVLHAGGK
FT                   FDDNAYKVSGGLHGVGVSVVNALSETLQLRIFRDGYVWTQEYHDGEPQAPIARGDASRK
FT                   HGSTIRFKPSPQVFADTHFHFEIIAKRLRELAFLNSGVHITLLDERASREETFHYEGGI
FT                   RAFVEHLNRSKTAIHPSVITLTGERDGIVVEAALQWNEGYNEAVLCFTNNIPQADGGTH
FT                   LAGFRGALTRTLNQYMEREGIIAKAKVAVSGEDAREGLTAVLSVKVPDPKFSSQTKEKL
FT                   VSSEVKPIVESSMSEALTMFLDEHPKEAQAIAAKIVEAARAREAARRARELTRRKGALD
FT                   IANLPGKLADCQEKDPAQCEIYLVEGDSAGGSAKQGRDRRHQAILPLKGKILNVERARF
FT                   DRMLSSDEIGTLITALGTGIGAGDFDVAKLRYHRVIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPDLVARGHIYIAQPPLYKVKKGKEERYLKDDGELAAYLREIAMQGAQFRPAADAEPVT
FT                   DEQLGGMMRQYQNIEALVQRLERRYPSTLLWALATLPPIVAESADSATWDDFARQLRAA
FT                   LEVNALPAEHYTVERVGEAEALRLVVRREHHGSVELRFFDQDFFAGGEYRHLADYARQI
FT                   EGKIGVGARMERGERGLAVSRFRTAMDWLLADARRGVEIQRYKGLGEMNPEQLWETTMN
FT                   AANRRLVRVDVEDAIAADEVFSMLMGDAVEPRRRFIEENARFVSRLDI"
FT                   /transl_table="11"
FT                   /protein_id="YP_002218473.1"
FT   misc_feature    4042..6444
FT                   /note="DNA gyrase subunit B; Provisional; Region: gyrB;
FT                   PRK14939"
FT                   /db_xref="CDD:184903"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    4138..>4374
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:185789"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    4699..5139
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    4852..4854
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    order(5026..5028,5035..5040,5044..5046)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    order(5044..5046,5050..5052)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    5293..5637
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    order(5311..5316,5323..5325,5533..5535,5539..5541,
FT                   5545..5547)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    order(5311..5313,5533..5535)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Lferr_0004"
FT   misc_feature    6220..6411
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Lferr_0004"
FT   gene            6592..10098
FT                   /db_xref="GeneID:6875954"
FT                   /locus_tag="Lferr_0005"
FT   CDS_pept        6592..10098
FT                   /locus_tag="Lferr_0005"
FT                   /gene_family="HOG000230305" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: noc:Noc_1583 hypothetical protein"
FT                   /db_xref="GI:198282153"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:6875954"
FT                   /translation="MTREILVLNLLNFEYKELFTSEGLARLDGEFLRVLAEKDQTLVED
FT                   LQVYRAAGARPADKAQSEFLLRLAPHLERFVAQLFHLGSEVAALQARTRSHDVVMAFKK
FT                   HFVLRRARRYRGEFPESFADLDQWLDSEIRQRGWPLEDREWAIARLGEAWLEDEAAHAV
FT                   AIDRLTRWCARILSDPQAALAVQGWSSFRLPQRVDHEALVPLKRREDLPGAPFVAPDGT
FT                   LRRRDSFHLTDLRMDARSVQNEVHYCLYCHDHEGDFCSKGFPEKKGVPELGLKVDPLGV
FT                   TLTGCPLEEKISEMQVLKRDGFHIAALAMAMVDNPMVPATGHRICNDCMKACVYQKQDP
FT                   VNIPQIETRILTDVLNLPWGVELYDLLTRWNPLRAVQYLAQPYNGRKVLVAGMGPAGFT
FT                   MAHHLLQEGCAVVGIDGLKVEPLPRQWLEQPIRDWSHLQEDLDERILLGFGGVAEYGIT
FT                   VRWDKNFLKLIYLTLARRSNFQIFGGVRLGGTITLENAWELGFDHVCIATGAGLPRVVP
FT                   MGESLARGMRQASDFLMALQLTGAGKRSSLANLQVRLPAVVIGGGLTAVDTATEVQAYY
FT                   VRQVEKVLARYEAMVTHSGEEKLRAGLSAEDAGILDEFLTHGRAVRAERERAAAGNESP
FT                   NFVPLIQSWGGVTLAYRKGMQQAPAYTRNHEELIKAMEEGIYYGEGLDPLRAELDSYGH
FT                   IAHMVFRQMREVEGRWLASDQDVRLPARAVFIAAGTVPNTIYEREYPGTFQLDGDHFLT
FT                   HVAHDNGPLQAVQVAEHCKAPEAGPFTSYGDAQGHRISFIGDTHPVFHGSVVKAIASAK
FT                   ATYPQVMQSLGTLDTAVDPDVHGFQQRLQHLLSMRVLRMDRSNPAVTEMWVEAPLAARN
FT                   FRPGQFFRLQTFESHSPIVDGTRLQIPVLTVSGAGVEGDAVRLMILQWGTGPRLVGRLQ
FT                   PGDPLILMGPTGAPTDIPSGKTILVVAGRWGAAVMLDIGPALRAAGNRVLYVAALGKAS
FT                   ELDHQAELEEAADQIIWCTGSGSLIETHRQQDLSVEASDMVALLRAYGAGELPGQKAHG
FT                   MEIALNSVDRLMVMGSTGLLKAFQQALQGELQPYFRADLEATATVGSPMQCMLKGVCAQ
FT                   CLQWQIDPETGQRTKAVFSCAQQDQPLAWVDLDNLTARQSQNRLLERLSSQWLDHLTFR
FT                   GI"
FT                   /protein_id="YP_002218474.1"
FT   misc_feature    6622..9537
FT                   /note="putative bifunctional glutamate synthase subunit
FT                   beta/2-polyprenylphenol hydroxylase; Validated; Region:
FT                   PRK06567"
FT                   /db_xref="CDD:168614"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    9154..9993
FT                   /note="FAD/NAD binding domain (electron transfer subunit)
FT                   of dihydroorotate dehydrogenase-like proteins.
FT                   Dihydroorotate dehydrogenases (DHODs) catalyze the only
FT                   redox reaction in pyrimidine de novo biosynthesis. They
FT                   catalyze the oxidation of (S)-...; Region:
FT                   DHOD_e_trans_like; cd06192"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9274..9276,9280..9285,9289..9294,9334..9342,
FT                   9358..9366,9469..9471,9874..9879)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9280..9282,9289..9294)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9355..9357,9364..9366,9373..9375,9385..9387,
FT                   9409..9411,9415..9417)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9454..9456,9466..9477,9481..9483)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9469..9474,9541..9549,9778..9783)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   misc_feature    order(9886..9888,9904..9906,9913..9915,9970..9972)
FT                   /note="Iron coordination center; other site"
FT                   /db_xref="CDD:99789"
FT                   /locus_tag="Lferr_0005"
FT   gene            10193..10705
FT                   /db_xref="GeneID:6875955"
FT                   /locus_tag="Lferr_0006"
FT   CDS_pept        10193..10705
FT                   /locus_tag="Lferr_0006"
FT                   /gene_family="HOG000219297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Spore coat U domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   gbe:GbCGDNIH1_1327 protein U precursor"
FT                   /db_xref="GI:198282154"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="GeneID:6875955"
FT                   /translation="MKLFREQHKKLFFGLSVLSTLTLGLLSGQTEASTATATFTVTATV
FT                   AATCTISATNLAFGTYTGAVTNANSTVTVTCTNTTPYNVGLNAGTATAATVSTRAMTGP
FT                   SSATLSYGLFQDAAYTTNWGNTVGTDTKTGTGNGSAQALTVYGQIPAGQYPAPGTYTDT
FT                   ITATITY"
FT                   /protein_id="YP_002218475.1"
FT   sig_peptide     10193..10291
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 33"
FT                   /locus_tag="Lferr_0006"
FT   misc_feature    <10445..10666
FT                   /note="Spore Coat Protein U domain; Region: SCPU; cl02253"
FT                   /db_xref="CDD:154822"
FT                   /locus_tag="Lferr_0006"
FT   gene            10719..11462
FT                   /db_xref="GeneID:6875956"
FT                   /locus_tag="Lferr_0007"
FT   CDS_pept        10719..11462
FT                   /locus_tag="Lferr_0007"
FT                   /gene_family="HOG000072826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein EcpD"
FT                   /transl_table="11"
FT                   /note="KEGG: gbe:GbCGDNIH1_1328 chaperone protein EcpD"
FT                   /db_xref="GI:198282155"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="GeneID:6875956"
FT                   /translation="MWSGAANIRRLIVGVTSIFIISFAVGIASAVSLTVLPVIIQMAPG
FT                   QKATTLTVINHGNREIAFQVRTFAWTQVSGHNKLTPTAELLASPPLGTLAPGGRQIIRM
FT                   VLRRPPQGREASYRILLDEIPPPAAPGMVRIALRMSIPIFAEPQTRVAPHVLWQVERRN
FT                   GQTFLVGINDGTRHETLRDIKLQAPGGGTLKVESNINPYILAGATMRWHIVTPSSPLAP
FT                   GAVLQLTARTNTGHIDQSVRVVGSP"
FT                   /protein_id="YP_002218476.1"
FT   sig_peptide     10719..10811
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.924 at
FT                   residue 31"
FT                   /locus_tag="Lferr_0007"
FT   misc_feature    10737..11375
FT                   /note="P pilus assembly protein, chaperone PapD [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: FimC; COG3121"
FT                   /db_xref="CDD:32935"
FT                   /locus_tag="Lferr_0007"
FT   misc_feature    10806..11165
FT                   /note="Gram-negative pili assembly chaperone, N-terminal
FT                   domain; Region: Pili_assembly_N; pfam00345"
FT                   /db_xref="CDD:144076"
FT                   /locus_tag="Lferr_0007"
FT   gene            11449..13872
FT                   /db_xref="GeneID:6875957"
FT                   /locus_tag="Lferr_0008"
FT   CDS_pept        11449..13872
FT                   /locus_tag="Lferr_0008"
FT                   /gene_family="HOG000219295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /transl_table="11"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: gbe:GbCGDNIH1_1329 outer membrane usher
FT                   protein SefC"
FT                   /db_xref="GI:198282156"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="GeneID:6875957"
FT                   /translation="MAVHDQSRSFAIRFAAAIVVALILMGAAQRAIAGGGETLLLSVVV
FT                   NGYHTGKIGEFRLNKGTLRARPQELHDLGFKVPKSIPVGTDGRVALSELPDFAWHIDQA
FT                   TQTLYVTVGSKRLLPQLLHTETSPASELPVQSGLGATLDYDVTGTSVAGQKLGAGQFNF
FT                   RAFSPWGVASSGLLAYVGGGPQGLGTNAVIRLNSTYTYSDPETLRRYRVGDFITGGLSW
FT                   TRPVRLGGIQISSDFSMRPDLITFPLPGVSGTVAVPSTVNVLVNGMQVLSSQVRPGPFE
FT                   IPQVPMITGAGTVVTTVTNALGQQVTTTLPFYASANLLAPGLQTFSAGLGFVRLNWGFL
FT                   SNDYGPLAGSITFRRGLTDALTVEAHAEGTRGVAMAGGGIVVNIDNRGVLNLSAAGSTS
FT                   QGHTGAQFSVGVQRIGRVFSAGASAIFADPDFRDIAAMNGDPVPTRQISANVGLSLGRF
FT                   GSFGISYAGIDRNAASMPIPVYAPPGTVVTEGGAPVSVYYFLPAEHAHILSASYSLQIG
FT                   PVSFYATGYHDFANSGDSGVQMGVTIPLGSRSSIGGSLASSSGNDSAQVQLMQSPVTIG
FT                   DWGYQAYATTGRTSQEFGQLQYKSPWGLVSAGASRIDRQTLVQGEVRGALSFMDGGLFA
FT                   SNTINNSFAIVDTDGFGNIRVLDENRLVGRTDSAGQLLVPDLRSYQANHIAIDPNDVPI
FT                   NATLPYATRDVRPPDRSGVVVKFPIRASYGALLRLVDQSGKNLPVGSVATLQKTGVSVP
FT                   VGYDGEAYVVNLSPHNRLLVERPDGQRCIVTFTYHPIAGTIPSIGPLTCRKDGP"
FT                   /protein_id="YP_002218477.1"
FT   sig_peptide     11449..11550
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.918 at
FT                   residue 34"
FT                   /locus_tag="Lferr_0008"
FT   misc_feature    11560..13857
FT                   /note="P pilus assembly protein, porin PapC [Cell motility
FT                   and secretion / Intracellular trafficking and secretion];
FT                   Region: FimD; COG3188"
FT                   /db_xref="CDD:33001"
FT                   /locus_tag="Lferr_0008"
FT   misc_feature    11653..13806
FT                   /note="pilin outer membrane usher protein SafC;
FT                   Provisional; Region: PRK15223; cl14650"
FT                   /db_xref="CDD:187404"
FT                   /locus_tag="Lferr_0008"
FT   gene            13869..14333
FT                   /db_xref="GeneID:6875958"
FT                   /locus_tag="Lferr_0009"
FT   CDS_pept        13869..14333
FT                   /locus_tag="Lferr_0009"
FT                   /gene_family="HOG000219297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Spore coat U domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   gbe:GbCGDNIH1_1330 hypothetical secreted protein"
FT                   /db_xref="GI:198282157"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="GeneID:6875958"
FT                   /translation="MKRKLALAALLIFAPTAVDAACSVTATGVAFGTYVPSAASNSTGT
FT                   VTVSCSATLGLLFNWTIALNAGVNSGGSFSNRRMASGNSYLSYQLYTDSGHTTVWGDGT
FT                   SGTATVSGNCLISFLGIPCSGSATVYGQIPALQNPSPGAYTDTITVTVTY"
FT                   /protein_id="YP_002218478.1"
FT   sig_peptide     13869..13931
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.744 at
FT                   residue 21"
FT                   /locus_tag="Lferr_0009"
FT   misc_feature    14124..14321
FT                   /note="Spore Coat Protein U domain; Region: SCPU; cl02253"
FT                   /db_xref="CDD:154822"
FT                   /locus_tag="Lferr_0009"
FT   gene            complement(14356..14484)
FT                   /db_xref="GeneID:6875959"
FT                   /locus_tag="Lferr_0010"
FT   CDS_pept        complement(14356..14484)
FT                   /locus_tag="Lferr_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Septum formation topological specificity factor
FT                   MinE"
FT                   /transl_table="11"
FT                   /note="PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: bbr:BB4016 putative cell division
FT                   topological specificity factor"
FT                   /db_xref="GI:198282158"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="GeneID:6875959"
FT                   /translation="MRGSTIDRPDFLPALQEELLAVIAKYIPVDKENIKVSMERRG"
FT                   /protein_id="YP_002218479.1"
FT   misc_feature    complement(14359..>14466)
FT                   /note="Septum formation topological specificity factor
FT                   MinE; Region: MinE; cl00538"
FT                   /db_xref="CDD:186067"
FT                   /locus_tag="Lferr_0010"
FT   gene            complement(14492..14926)
FT                   /db_xref="GeneID:6875960"
FT                   /locus_tag="Lferr_0011"
FT   CDS_pept        complement(14492..14926)
FT                   /locus_tag="Lferr_0011"
FT                   /gene_family="HOG000024905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr1121 hypothetical protein"
FT                   /db_xref="GI:198282159"
FT                   /db_xref="GeneID:6875960"
FT                   /translation="MDQVDKILERDWDAANQRGQETLAAGPLAVSAYYDQPTGKVVVEL
FT                   NNGVGLHIPPALIQGMEHATPADMAEIVIEGHGIGLRFPRLDADLYVPALARGVLGASA
FT                   WMRSLGRKGGISKSPAKAEAARKNGRLGGRPPSTEKKAVP"
FT                   /protein_id="YP_002218480.1"
FT   misc_feature    complement(14624..14851)
FT                   /note="Protein of unknown function (DUF3532); Region:
FT                   DUF3532; pfam12050"
FT                   /db_xref="CDD:152485"
FT                   /locus_tag="Lferr_0011"
FT   gene            complement(15259..15510)
FT                   /db_xref="GeneID:6875961"
FT                   /locus_tag="Lferr_0012"
FT   CDS_pept        complement(15259..15510)
FT                   /locus_tag="Lferr_0012"
FT                   /gene_family="HOG000218362" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: rfr:Rfer_0034 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="GI:198282160"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="GeneID:6875961"
FT                   /translation="MSFLDYFLGSRKKSANVAKDRLKLILAHERDADGPDFLPALQEEL
FT                   LAVIAKYIPVDKENIKVSMERRGDFEVLELNVLFPDQH"
FT                   /protein_id="YP_002218481.1"
FT   misc_feature    complement(15265..15510)
FT                   /note="Septum formation topological specificity factor
FT                   MinE; Region: MinE; cl00538"
FT                   /db_xref="CDD:186067"
FT                   /locus_tag="Lferr_0012"
FT   gene            complement(15512..16321)
FT                   /db_xref="GeneID:6875962"
FT                   /locus_tag="Lferr_0013"
FT   CDS_pept        complement(15512..16321)
FT                   /locus_tag="Lferr_0013"
FT                   /gene_family="HOG000019419" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="septum site-determining protein MinD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: cvi:CV_3376
FT                   septum site-determining protein MinD"
FT                   /db_xref="GI:198282161"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="GeneID:6875962"
FT                   /translation="MAKIIVITSGKGGVGKTTTSAAFASGLALRGYRTVVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEAKLQQALIKDKRCENLYVLPTSQTRDKDALTTEGVTA
FT                   VMDELRKDFDYIVCDSPAGIESGALMALYHADEAIVVTNPEVSSVRDSDRILGILAARS
FT                   RRAEQGEEPVKEHLLLTRYSPKRVEDGEMLSLGDVKELLRTPLLGVIPESEVILQASNQ
FT                   GIPAIHMENSDVAEAYKDVVARFLGEERPLRFIQPVKVGFFKRLFGG"
FT                   /protein_id="YP_002218482.1"
FT   misc_feature    complement(15515..16261)
FT                   /note="cell division inhibitor MinD; Provisional; Region:
FT                   PRK10818"
FT                   /db_xref="CDD:182756"
FT                   /locus_tag="Lferr_0013"
FT   misc_feature    complement(15608..16261)
FT                   /note="Bacterial cell division requires the formation of a
FT                   septum at mid-cell. The site is determined by the min
FT                   operon products MinC, MinD and MinE. MinC is a nonspecific
FT                   inhibitor of the septum protein FtsZ. MinE is the supressor
FT                   of MinC. MinD plays a...; Region: MinD; cd02036"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Lferr_0013"
FT   misc_feature    complement(16202..16210)
FT                   /note="Switch I; other site"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Lferr_0013"
FT   misc_feature    complement(15953..15967)
FT                   /note="Switch II; other site"
FT                   /db_xref="CDD:73299"
FT                   /locus_tag="Lferr_0013"
FT   gene            complement(16340..17071)
FT                   /db_xref="GeneID:6875963"
FT                   /locus_tag="Lferr_0014"
FT   CDS_pept        complement(16340..17071)
FT                   /locus_tag="Lferr_0014"
FT                   /gene_family="HOG000062060" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="septum site-determining protein MinC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; Septum formation inhibitor
FT                   MinC domain protein; KEGG: psa:PST_1425 septum
FT                   site-determining protein MinC"
FT                   /db_xref="GI:198282162"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="GeneID:6875963"
FT                   /translation="MANPRSPGTESSAPLRVSGGVFTLSILHLESNNPQQLAQRIAEEH
FT                   RRHPAAADFHRHAPVVLDLSAIPEEAPLALPEILEVLRAANWFPVGLRNAAPGHQALAQ
FT                   ALHLPVLRGQERNAALQPETPPPAQPVPANPGGLIMDHPIRGGQRSYARGGDLVCLAAV
FT                   NAGAEIMADGNIHVYGPLRGRALAGVNGQETARIFCMSLEAELVSVAGLYRTLEPGYPL
FT                   WGKAAQIYSRDEQLHITALNI"
FT                   /protein_id="YP_002218483.1"
FT   misc_feature    complement(16739..17032)
FT                   /note="Septum formation inhibitor MinC, N-terminal domain;
FT                   Region: MinC_N; pfam05209"
FT                   /db_xref="CDD:113960"
FT                   /locus_tag="Lferr_0014"
FT   misc_feature    complement(16349..17017)
FT                   /note="septum site-determining protein MinC; Region: minC;
FT                   TIGR01222"
FT                   /db_xref="CDD:162259"
FT                   /locus_tag="Lferr_0014"
FT   misc_feature    complement(16349..16660)
FT                   /note="Septum formation inhibitor MinC, C-terminal domain;
FT                   Region: MinC_C; pfam03775"
FT                   /db_xref="CDD:146423"
FT                   /locus_tag="Lferr_0014"
FT   gene            complement(17102..17428)
FT                   /db_xref="GeneID:6875964"
FT                   /locus_tag="Lferr_0015"
FT   CDS_pept        complement(17102..17428)
FT                   /locus_tag="Lferr_0015"
FT                   /gene_family="HOG000044610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur-binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: hha:Hhal_1658 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="GI:198282163"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="GeneID:6875964"
FT                   /translation="MTYVVTENCIQCKYTDCAEVCPVECFHEGPNFLVIDPVECIDCAA
FT                   CVPECPADAIFADDEVPPDQRDFTAINAELARDWPVILRKKAALPDAETWNGKGDKRPL
FT                   LRRS"
FT                   /protein_id="YP_002218484.1"
FT   misc_feature    complement(17234..17419)
FT                   /note="Ferredoxin [Energy production and conversion];
FT                   Region: COG1146"
FT                   /db_xref="CDD:31341"
FT                   /locus_tag="Lferr_0015"
FT   misc_feature    complement(17108..17254)
FT                   /note="Domain of unknown function (DUF3470); Region:
FT                   DUF3470; pfam11953"
FT                   /db_xref="CDD:152388"
FT                   /locus_tag="Lferr_0015"
FT   gene            complement(17425..19980)
FT                   /db_xref="GeneID:6875965"
FT                   /locus_tag="Lferr_0016"
FT   CDS_pept        complement(17425..19980)
FT                   /locus_tag="Lferr_0016"
FT                   /gene_family="HOG000004018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: mca:MCA2839 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="GI:198282164"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="GeneID:6875965"
FT                   /translation="MAHQLVIVESPAKAKTIQKYLGDDFQVLASYGHVRDLQPKEGAVD
FT                   TEHDFAMRYTPIERNERHVDAIAKALRGADKLWLATDPDREGEAISWHLVELLRERQLL
FT                   GDKPTQRVVFHEITKKAVQEAIAHPREIAMDLVNAQQARRALDYLVGFNLSPLLWRKVR
FT                   PGLSAGRVQSAALRLICERENEIEAFVSREYWTIASRLQHAGSAFTGRLTHWQNKKLEQ
FT                   FDIADGDQAQAIRSGMEDDLGRQALRVREVERKSRQRQPAAPFTTSTLQQEASRKLGFN
FT                   ASRTMRVAQQLYEGINIGNETVGLISYMRTDAVNLAEEAIASIRTFIDGYYGSEFVPET
FT                   PRRYKTKTKNAQEAHEAIRPTDIARTPESLQGVLERDLWRLYDLVWKRSIACQMAPARL
FT                   DLVAVDMDAGTHWTLRANGSTVTFPGFMAVYQEGKDDGDEDESNRILPPLDVGDEPLVL
FT                   GIDPEQHFTEPPPRYSDATLVKTLEAHGIGRPSTYASIIQTLQNREYVAVEQRRFHPTD
FT                   LGRVVGRFLINHFERYVDYGFTASMEDELDAVSRGEKQWQPVLSAFWSPFRALLDEKAN
FT                   VSRAEATSEALEEACPQCGKPLFLRLGRHGRFVACSGYPECNYTRPVDGPREPAEPVGR
FT                   DCPDCGKPLVYKTGRYGRFISCSGYPECKHIEPLTQPKSSGVTCPQCGEGELVEKRSRY
FT                   GKVFYSCNTYPKCTYAVWGPPVARPCPRCGWPIMIEKSGKRLGEQLACPQSECAFHFPA
FT                   NASDAEIAALLPGYSPPPPREKRAPPAKKAAPARKTTAKTAKKPATEATAVAAQKTAKA
FT                   KTTSAAAKKPAASKARGPSAGEGKTSPSRKRAAKGASDS"
FT                   /transl_table="11"
FT                   /protein_id="YP_002218485.1"
FT   misc_feature    complement(17965..19980)
FT                   /note="DNA topoisomerase I; Validated; Region: PRK06599"
FT                   /db_xref="CDD:180637"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(19594..19968)
FT                   /note="TOPRIM_TopoIA_TopoI: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to Escherichia coli
FT                   DNA topoisomerase I.   Type IA DNA topoisomerases remove
FT                   (relax) negative supercoils in...; Region:
FT                   TOPRIM_TopoIA_TopoI; cd03363"
FT                   /db_xref="CDD:173783"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(19723..19725,19729..19731,19735..19737,
FT                   19942..19944,19951..19956))
FT                   /note="active site"
FT                   /db_xref="CDD:173783"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(19693..19698,19702..19707,19726..19728,
FT                   19732..19734,19933..19935))
FT                   /note="interdomain interaction site; other site"
FT                   /db_xref="CDD:173783"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(19729..19731,19735..19737))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173783"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(19726..19728)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:173783"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(18268..19581)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(19423..19485,19498..19581))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18472..18477,18487..18489,18493..18498,
FT                   18505..18510,19051..19053,19099..19101,19111..19113,
FT                   19516..19518,19528..19530,19540..19542,19549..19554))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18400..18402,19438..19440,19450..19452))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18577..18609,18691..18744,18748..18750,
FT                   18754..18798,19201..19248,19390..19410))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18799..18861,18895..18921,18985..19071,
FT                   19096..19176,19180..19200))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18442..18444,18508..18510,18514..18516,
FT                   18820..18822,18832..18834,18841..18843,18916..18918,
FT                   19147..19155,19165..19167))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18916..18918,19051..19053,19057..19059))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(order(18268..18384,18400..18444,18454..18576))
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(18109..18210)
FT                   /note="Topoisomerase DNA binding C4 zinc finger; Region:
FT                   zf-C4_Topoisom; cl11977"
FT                   /db_xref="CDD:143760"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(17974..18081)
FT                   /note="Topoisomerase DNA binding C4 zinc finger; Region:
FT                   zf-C4_Topoisom; cl11977"
FT                   /db_xref="CDD:143760"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(17836..17955)
FT                   /note="Topoisomerase DNA binding C4 zinc finger; Region:
FT                   zf-C4_Topoisom; cl11977"
FT                   /db_xref="CDD:143760"
FT                   /locus_tag="Lferr_0016"
FT   misc_feature    complement(17713..>17952)
FT                   /note="DNA topoisomerase I/SWI domain fusion protein;
FT                   Validated; Region: PRK06319"
FT                   /db_xref="CDD:180527"
FT                   /locus_tag="Lferr_0016"
FT   gene            complement(19984..20424)
FT                   /db_xref="GeneID:6875966"
FT                   /locus_tag="Lferr_0017"
FT   CDS_pept        complement(19984..20424)
FT                   /locus_tag="Lferr_0017"
FT                   /gene_family="HOG000137865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   aeh:Mlg_2631 protein of unknown function DUF494"
FT                   /db_xref="GI:198282165"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="GeneID:6875966"
FT                   /translation="MEDVIDIISYLLDHLDEDDNDDMVEEHLRAVGFADGDIQRALDWM
FT                   EGFAVEEQEATSPRSLRAYHPYEQQSLSVAARGQLHDWERLGVINGAMRERIIDRLLAL
FT                   ELDDTDLETLDWVTFMVMANDPGPEAFWVDALLGNDGARILH"
FT                   /protein_id="YP_002218486.1"
FT   misc_feature    complement(19987..20352)
FT                   /note="Protein of unknown function (DUF494); Region:
FT                   DUF494; cl01103"
FT                   /db_xref="CDD:186336"
FT                   /locus_tag="Lferr_0017"
FT   gene            complement(20434..21531)
FT                   /db_xref="GeneID:6875967"
FT                   /locus_tag="Lferr_0018"
FT   CDS_pept        complement(20434..21531)
FT                   /locus_tag="Lferr_0018"
FT                   /gene_family="HOG000003904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA protecting protein DprA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: azo:azo0097 putative DNA processing
FT                   protein DrpA"
FT                   /db_xref="GI:198282166"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="GeneID:6875967"
FT                   /translation="MTDRAWLALGRIAGLGPIRQRALLERFGAVDRCFQTGAGALQGLG
FT                   LQAAQIAALQKAPEDVLTPADRRWLESPDTDLCRWTDSDYPPLLRHISDPPLLLYLRGQ
FT                   RACLNQAMLAIVGSRSPTASGVATAEAFARNLGEAGLIISSGLALGIDAAAHRGALNSG
FT                   TVAVLGTGADLIYPRSHLQLARQIAGQGLILSEQPPDTGPRSGLFPRRNRIISGLSLGV
FT                   LVVEAAEGSGSLITARLAMDQGREVFAIPGSIHSPLSRGPHRLIRDGAKLVESAEDVLS
FT                   ELGPLYAVLRNAQAMAPAADWQPEDPAQARVWAAMDFDPLAPEQIANRCGLTLTELSAI
FT                   LLDMELQGYLAACPGGRFCRLPPVS"
FT                   /protein_id="YP_002218487.1"
FT   misc_feature    complement(20458..21531)
FT                   /note="Predicted Rossmann fold nucleotide-binding protein
FT                   involved in DNA uptake [DNA replication, recombination, and
FT                   repair / Intracellular trafficking and secretion]; Region:
FT                   Smf; COG0758"
FT                   /db_xref="CDD:31101"
FT                   /locus_tag="Lferr_0018"
FT   misc_feature    complement(20707..21288)
FT                   /note="DNA recombination-mediator protein A; Region:
FT                   DNA_processg_A; cl00695"
FT                   /db_xref="CDD:153941"
FT                   /locus_tag="Lferr_0018"
FT   gene            complement(21528..22577)
FT                   /db_xref="GeneID:6875968"
FT                   /locus_tag="Lferr_0019"
FT   CDS_pept        complement(21528..22577)
FT                   /locus_tag="Lferr_0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidoglycan-binding LysM"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   pau:PA14_00210 putative lysin domain"
FT                   /db_xref="GI:198282167"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="GeneID:6875968"
FT                   /translation="MQKNIWRNTLFCLGLCAMAPVMAQAAPSGTLLRTAHSYTVKRGDT
FT                   LWGIAAHFLKNPWEWPRLWHRNTYIKNPNLIYPGDRVVITRGPGGQPELRVIALHPQMT
FT                   AEPLPTVARGEVMPFLGNPGVIASKKAYDQLPYLAASASEHIVYAVGDKLYASGLAHAP
FT                   VGAHYQIVALGPELYRPGRKNAVGYALRDLGSAVVRRNGAHAAMEITNALKEISLGDRL
FT                   IPATKSVVPHYFPSAPSHPVKAHIIAKMSDYPEIMVGQVVIVDQGREDGLRDGNVLQIE
FT                   RAAETTKNAVTGKTFALPPQKVGSVMLFRVFPTVSYAVITTATRGIQVGDHLASPSPVT
FT                   ASDSSAGNG"
FT                   /protein_id="YP_002218488.1"
FT   sig_peptide     complement(22500..22577)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.762 at
FT                   residue 26"
FT                   /locus_tag="Lferr_0019"
FT   misc_feature    complement(22323..22466)
FT                   /note="Lysin domain, found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function; Region: LysM;
FT                   cl00107"
FT                   /db_xref="CDD:153515"
FT                   /locus_tag="Lferr_0019"
FT   gene            22660..23163
FT                   /db_xref="GeneID:6875969"
FT                   /locus_tag="Lferr_0020"
FT   CDS_pept        22660..23163
FT                   /locus_tag="Lferr_0020"
FT                   /gene_family="HOG000243509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: tbd:Tbd_0014 formylmethionine deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="GI:198282168"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="GeneID:6875969"
FT                   /translation="MPLLKILEIPDARLKDVARPIARVDKQIQQLADDMAETMYDAPGI
FT                   GLAAPQVAAGHRLIVVDVSENRNDLLTLLNPEIIARTGEEEMKEGCLSVPGVLETVRRA
FT                   EKVTVRATTVQGKTVELEADGLLAVCLQHEIDHLDGTLFIDHLSRLKQSLIRRKAEKRV
FT                   RLGD"
FT                   /transl_table="11"
FT                   /protein_id="YP_002218489.1"
FT   misc_feature    22675..23088
FT                   /note="Polypeptide or peptide deformylase; a family of
FT                   metalloenzymes that catalyzes the removal of the N-terminal
FT                   formyl group in a growing polypeptide chain following
FT                   translation initiation during protein synthesis in
FT                   prokaryotes. These enzymes utilize Fe...; Region:
FT                   Pep_deformylase; cd00487"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Lferr_0020"
FT   misc_feature    order(22789..22797,22810..22812,22927..22935,23056..23061,
FT                   23068..23070)
FT                   /note="active site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Lferr_0020"
FT   misc_feature    order(22795..22797,22810..22812,22933..22935,23059..23061)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Lferr_0020"
FT   misc_feature    order(22930..22932,23056..23058,23068..23070)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Lferr_0020"
FT   gene            23156..24097
FT                   /db_xref="GeneID:6875970"
FT                   /locus_tag="Lferr_0021"
FT   CDS_pept        23156..24097
FT                   /locus_tag="Lferr_0021"
FT                   /gene_family="HOG000261177" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: aeh:Mlg_2627
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="GI:198282169"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="GeneID:6875970"
FT                   /translation="MTEKQRIVFAGTPEFARITLAELRQGPEAVVGVFTQPDRPAGRGR
FT                   TLQASPVKQEALAAGIPVFQPESCKTGEALELLRSLAPDLLIVVAYGQILPQAILALPT
FT                   RGAINVHASLLPAWRGAAPIARAIAAGDKESGVAIMQMEAGLDSGPVLWEERLPIAADD
FT                   TAASLHDRLARLGGKALRHVLDDLWAERLKPVPQDPALVTYAHKLKKEEALLDWRLPAA
FT                   TLERLVRAFNPSPVAHTLFRDKGLRVWQARVLGAGGDQAPGSISAVEKDGVVVTCGEDR
FT                   LQLLAVQPAGKGVLSGSDFARGYRPQVGEVLG"
FT                   /protein_id="YP_002218490.1"
FT   misc_feature    23171..24094
FT                   /note="methionyl-tRNA formyltransferase; Reviewed; Region:
FT                   fmt; PRK00005"
FT                   /db_xref="CDD:178787"
FT                   /locus_tag="Lferr_0021"
FT   misc_feature    23171..23707
FT                   /note="Formyl transferase; Region: Formyl_trans_N; cl00395"
FT                   /db_xref="CDD:185966"
FT                   /locus_tag="Lferr_0021"
FT   misc_feature    23774..24070
FT                   /note="Formyl transferase, C-terminal domain; Region:
FT                   Formyl_trans_C; pfam02911"
FT                   /db_xref="CDD:145851"
FT                   /locus_tag="Lferr_0021"
FT   gene            24103..25398
FT                   /db_xref="GeneID:6875971"
FT                   /locus_tag="Lferr_0022"
FT   CDS_pept        24103..25398
FT                   /locus_tag="Lferr_0022"
FT                   /gene_family="HOG000037300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sun protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: pfl:PFL_0020 sun protein"
FT                   /db_xref="GI:198282170"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR006174"
FT                   /db_xref="GeneID:6875971"
FT                   /translation="MRTGIERAKSTSGGAVRKAAITVLRGVDSGQTVDAALLPVSLTGT
FT                   DRATLQWLVLGTLREFLSVQALSAKLLRKPWREEDADLGFLLSLALFELRHGQRPAFAV
FT                   VNDWVEMTEAVKKPWARGLMNAVLRRYLREREVLDTALVDRDLGHPAWLAARLRAAYPQ
FT                   DWPAIAAANNSAPPLWLRVNTQRVDPGAYRRLLAEQGREAEGVTWSAAALCLPASVPVA
FT                   TLPGWDAGWVAVQDGAAQLAAHILAPREGERILDACAAPGGKTAHLWALGATRLDALDR
FT                   SAERLNRVRETLERQGGEVHLQAADAAETATWWNGETYDAILLDAPCTGTGVIRRHPDI
FT                   RLRRQPEDVAEAVAQQARLLEGLWPCLRPGGRLLYATCSVLPEENEEQIAAFVQRHSDA
FT                   RRMAHPLTGQRLPGQEDMDGFYYALLEKDACA"
FT                   /protein_id="YP_002218491.1"
FT   misc_feature    24148..24480
FT                   /note="RNA binding domain of NusB (N protein-Utilization
FT                   Substance B) and Sun (also known as RrmB or Fmu) proteins.
FT                   This family includes two orthologous groups exemplified by
FT                   the transcription termination factor NusB and the
FT                   N-terminal domain of the rRNA-...; Region: NusB_Sun;
FT                   cl00223"
FT                   /db_xref="CDD:185841"
FT                   /locus_tag="Lferr_0022"
FT   misc_feature    24148..24153
FT                   /note="putative RNA binding site; other site"
FT                   /db_xref="CDD:29564"
FT                   /locus_tag="Lferr_0022"
FT   misc_feature    24157..25386
FT                   /note="16S rRNA methyltransferase B; Provisional; Region:
FT                   PRK10901"
FT                   /db_xref="CDD:182822"
FT                   /locus_tag="Lferr_0022"
FT   misc_feature    24859..25227
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Lferr_0022"
FT   misc_feature    order(24871..24891,24940..24945,25015..25020,25024..25026,
FT                   25075..25077)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Lferr_0022"
FT   gene            25389..25988
FT                   /db_xref="GeneID:6875972"
FT                   /locus_tag="Lferr_0023"
FT   CDS_pept        25389..25988
FT                   /locus_tag="Lferr_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mca:MCA2846 hypothetical protein"
FT                   /db_xref="GI:198282171"
FT                   /db_xref="GeneID:6875972"
FT                   /translation="MRLSSALGLSVGRSRQRLLVVILLGLGGIFCATGAAVAGPAFHVE
FT                   RVRVIPHANAVEIDASVQLGKEALLQQVLDQGQTLTWVVEAEWREPEPFSFIPGIGVHA
FT                   RREQRWHIRYYPLTNQYAIEDQQGVLTLYAQWSEVVTALSRVRNFVLPLAHGAARGEVA
FT                   LRVYVDSQALPLPLRLRSLLDHWKLESPWTVVPLPR"
FT                   /protein_id="YP_002218492.1"
FT   sig_peptide     25389..25505
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.913 at
FT                   residue 39"
FT                   /locus_tag="Lferr_0023"
FT   gene            25961..28171
FT                   /db_xref="GeneID:6875973"
FT                   /locus_tag="Lferr_0024"
FT   CDS_pept        25961..28171
FT                   /locus_tag="Lferr_0024"
FT                   /gene_family="HOG000266158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: aeh:Mlg_2624 multi-sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="GI:198282172"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:6875973"
FT                   /translation="MDRRTPSPLKNWLRALSTGTTGEQLRVGPRWDAVLLLLAIVAFLG
FT                   INFFTSAGGPLSHYFVPMLVISAGIVLFLLSLVLISVVALLLRLRRGEVGSQLATRLVV
FT                   IITLLSFLPAAVVFGFSWQYLNRGVDSWFSSAVQSALDQALNVAKAGVDRYRNSTLLAA
FT                   ESIAQALVGESDSSAVITVIALRDQYRLSSVTLFSSDNRIIATSSDNLSLAPRVPRREI
FT                   LAMEEGHPTATIEPEPKGGLLVKVLIPVLSPHLGESNRMLYVEQPIPEQLTRAAEAVQV
FT                   AYTRYHQLMLMREPMKTAFQLSLAVALLLAVLSAVWMGLHLARRLTAPIARLAAGTQAV
FT                   ARGEFIPLQTVASHDELGVLIHSFNNMTRQLARAKQQAAAAQEQAEQRRLYLETVLGQI
FT                   SSGILTFDGENRLAEVNAAATHILQEDLLRGSALEGLHDGTALEPLWKLVADWVEHPRN
FT                   GMQKELQIERSDGPQTIIVHGAHFADDAGSRGFVLVFDDISTLVAAQRSAAWSEVARRL
FT                   AHEIKNPLTPIQLSAERLRRKYLERLGDEGETLDRATRTIIHQVDALKVMVDAFSEYAR
FT                   QPQLELRPLDLNTLILDVLDLYRGQESGVEIRAELGAGLPPLRADVHRLRQILNNLLRN
FT                   ALDALQGGVESTDGKHILIRTRLTDAGPTKMLELSVLDDGPGFPVELLARVFEPYVSTK
FT                   VKGSGLGLAIVRRIVEEHGGQIIADNQGLQGGARIVIDFPLG"
FT                   /protein_id="YP_002218493.1"
FT   misc_feature    26249..28168
FT                   /note="Signal transduction histidine kinase involved in
FT                   nitrogen fixation and metabolism regulation [Signal
FT                   transduction mechanisms]; Region: NtrY; COG5000"
FT                   /db_xref="CDD:34605"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    <26924..27061
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    27479..27688
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    order(27497..27499,27509..27511,27521..27523,27530..27532,
FT                   27542..27544,27551..27553,27617..27619,27629..27631,
FT                   27638..27640,27650..27652,27659..27661,27671..27673)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    27515..27517
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    27902..28159
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    order(27971..27973,27977..27979,27983..27985,27989..27994,
FT                   28055..28066,28112..28114,28118..28120,28136..28141,
FT                   28145..28147)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0024"
FT   misc_feature    order(27983..27985,27989..27991,28055..28057,28061..28063)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0024"
FT   gene            28193..29599
FT                   /db_xref="GeneID:6875974"
FT                   /locus_tag="Lferr_0025"
FT   CDS_pept        28193..29599
FT                   /locus_tag="Lferr_0025"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component sigma-54 specific Fis family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; KEGG: mca:MCA2848 nitrogen regulation protein
FT                   NtrX, putative"
FT                   /db_xref="GI:198282173"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:6875974"
FT                   /translation="MEDARLNILVVDDEPDICATLAEILEDEGYGVHTAGSAEAAEVLL
FT                   REQMVDLVLLDIWMPGEDGVSLLRRWAETGLAQPVVMMSGHATIETAVQATKLGAYDFI
FT                   EKPLSLDKTLLTVTHALESSRLQRENRDLRAQAGWVERPSGDSPAIRQFREQLQRVAAV
FT                   DSWALLLGEPGSGKEVAARYLHRRSRRAQGPFVDLRAAAIARPNVAVELFGSEEHGKLT
FT                   RGRLEVAHGGTLFIDEIADMDLETQARLFSALQERRIIRVGGTTPVPVDVRVIAGSAQD
FT                   LAHAVQSGQFRSDLYYRLSALPLKVPPLSARSVDIPVLIEEFVRFYGARDGLAPRRFAP
FT                   ETLEVLRHYPWPGNIRELQNLVERLLILAEGPEISAEEVEGALGLDNRLVLANSNFDGE
FT                   DFGGTLKRARERFERAFLEYHLARNEWNIARTAEVVGLERTHLYRKLKNLSIALKGERR
FT                   AGEDGDEGEG"
FT                   /protein_id="YP_002218494.1"
FT   misc_feature    28211..29554
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28217..28555
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    order(28226..28231,28358..28360,28382..28384,28442..28444,
FT                   28499..28501,28508..28513)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28358..28360
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    order(28367..28372,28376..28384)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28508..28516
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28634..29092
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28703..28726
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    order(28706..28729,28901..28903,29027..29029)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    28889..28906
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0025"
FT   misc_feature    29084..29086
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0025"
FT   gene            29596..29793
FT                   /db_xref="GeneID:6875975"
FT                   /locus_tag="Lferr_0026"
FT   CDS_pept        29596..29793
FT                   /locus_tag="Lferr_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_A0133 addiction module antitoxin,
FT                   putative"
FT                   /db_xref="GI:198282174"
FT                   /db_xref="GeneID:6875975"
FT                   /translation="MISKRGKPLVKTVPITDETRNSMFGYMKGSVTIHGDIVAPSGEVW
FT                   SAESGDEDHFYAGLRPREND"
FT                   /protein_id="YP_002218495.1"
FT   gene            29747..29914
FT                   /db_xref="GeneID:6875976"
FT                   /locus_tag="Lferr_0027"
FT   CDS_pept        29747..29914
FT                   /locus_tag="Lferr_0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:198282175"
FT                   /db_xref="GeneID:6875976"
FT                   /translation="MKTISMQACDPARTIKQPFYRHDPLRLETLAAILDAVPAHRGIRR
FT                   EVLLDLLFER"
FT                   /protein_id="YP_002218496.1"
FT   gene            30028..31521
FT                   /db_xref="GeneID:6875977"
FT                   /locus_tag="Lferr_0028"
FT   CDS_pept        30028..31521
FT                   /locus_tag="Lferr_0028"
FT                   /gene_family="HOG000072838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: mmw:Mmwyl1_4418 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="GI:198282176"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:6875977"
FT                   /translation="MVCAGFGVLLVQRKHEDLLLTAHISQSVALNFWRRLSVRSKSIIF
FT                   VLMLIAGIYGTIVLFLYTAVERNMEKQIHSKVLHLSRGLARDAADPLLSENSNTLIKLV
FT                   EQVENNPLIRHAIITDQQGLTVASTQSTAIGRQGLVPTNLEREEFTAPIRAGSHILGYV
FT                   SLRANNDVIQSIVDTRMDLAIRRLSFLGMITAFIGLIGASLISNTFTRPIRRLSQKMAD
FT                   VESRLHVDGFPQYSPIPGDGDEITRLEEGFKRLEQRLQQYLVELDQLHRRQQAMQCMAT
FT                   IGEMSAQVAHEIRNALSSLRGAARYLVRYEQPVNRQEFINIIEEEVQRLYDMTQGFLDF
FT                   GRPYHIKLTEVPALDLFFRSSKRHATDLEAKQITLTINCPPSLQVVADPQLFEQAISNL
FT                   LLNAVEALPNHGGCITLYGRREENGQFVAGVVDNGPGVPPERANDIFKPYVTGKAKGGG
FT                   LGLAVVTKIMMVHDGRVELRHREVGAEFALCLPPQGFGQ"
FT                   /protein_id="YP_002218497.1"
FT   misc_feature    30127..31365
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    30586..30810
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    30862..31053
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    order(30880..30882,30892..30894,30904..30906,30913..30915,
FT                   30925..30927,30934..30936,30982..30984,30994..30996,
FT                   31003..31005,31015..31017,31024..31026,31036..31038)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    30898..30900
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    31201..31497
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    order(31219..31221,31231..31233,31240..31242,31315..31317,
FT                   31321..31323,31327..31329,31333..31338,31411..31422,
FT                   31456..31458,31474..31479,31483..31485)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    31231..31233
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0028"
FT   misc_feature    order(31327..31329,31333..31335,31411..31413,31417..31419)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Lferr_0028"
FT   gene            31563..32930
FT                   /db_xref="GeneID:6875978"
FT                   /locus_tag="Lferr_0029"
FT   CDS_pept        31563..32930
FT                   /locus_tag="Lferr_0029"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component sigma-54 specific Fis family
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; SMART: AAA ATPase; KEGG: gsu:GSU1320 sigma-54
FT                   dependent DNA-binding response regulator"
FT                   /db_xref="GI:198282177"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:6875978"
FT                   /translation="MRSQKILIVEDEKNLRSVLAATLEAEGFSTAQTESAEDALAIMAR
FT                   ELPVLVLTDQRLPGMSGTELLARIKERWPRTPVLIATAYGEIEQAVQAIKAGAEHYLTK
FT                   PVDEGELVAIIRQALSCRGHTNPPRSQDLPRHGIIGESPGTLEILEMINLVAPAPSNVL
FT                   ITGESGTGKEMVARGLHVASPRAHAPFLAFNCGAIPLDLVESEIFGHEKGAFTGAVRSQ
FT                   AGKLEMAGSGTLFLDEVGDMPLAMQVKLLRTLQEREYTRLGGNQPLRLAARIIAATHVD
FT                   LAKAVEAGSFREDLYYRLNVIPLHIPPLRERREDVAPLVHHFLRRVCTELGRPEVDIAT
FT                   AALAAMEAYSWPGNIRQLENIVERLVVLNRGGTILAADLPNEMRTTETERIRPFGGAYD
FT                   LHAVEREAVVSALNKAQSNKSQAALLLGISRKQLHTRMKNLGLIVDREDVPGGEKL"
FT                   /protein_id="YP_002218498.1"
FT   misc_feature    31563..32900
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    31581..31919
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    order(31590..31595,31722..31724,31746..31748,31806..31808,
FT                   31863..31865,31872..31877)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    31722..31724
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    order(31731..31736,31740..31748)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    31872..31880
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    32031..32486
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    32058..32081
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    order(32061..32084,32271..32273,32397..32399)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    32259..32276
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    32454..32456
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Lferr_0029"
FT   misc_feature    32766..32876
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="Lferr_0029"
FT   gene            33353..34852
FT                   /db_xref="GeneID:6875979"
FT                   /locus_tag="Lferr_0030"
FT   CDS_pept        33353..34852
FT                   /locus_tag="Lferr_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyrrolo-quinoline quinone"
FT                   /transl_table="11"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: sto:ST1164
FT                   hypothetical outer membrane protein"
FT                   /db_xref="GI:198282178"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="GeneID:6875979"
FT                   /translation="MPSIVRNHGPHNKILLSALLLALFGWVPLASAAVAVPMDSTGPYR
FT                   TVSHPENAPSGVDAGVGPSEWTHAYANPAHNAAFPVPDDAPEWIRNGVSWLFPEARAWP
FT                   LANPPFGSKTYGAAEASVTQTQFYGNALGPSVVDGVVYAESDDMFAYAVNAKTGKLIWR
FT                   ASPVGNNLMGNPLVIGNTVYLSAGSVAFNFANVLRYAHNPSASARGLNVSFNGIYALNR
FT                   SNGKLLWYFATPGETMATPAYDNNTLFIADGAGNAFGINATTGKQVWKTHVGGMDNMSS
FT                   VTAYRHNIYFAMAIKPYLYCLNESNGHIVWKGTIPGASNTGIGDVSPAAADGVVVLDAT
FT                   TKPQANKKAMFSNVIRAFDAKTGAVLWTRNMGSGGKIPAFKGGVPMIHNNIVYVGNPVA
FT                   STYQAYELKTGKLLWTWHVPTKVAAGAGRSAPTYYKGLLYITTGQYIFVVNPATGKELH
FT                   QHHIGGQFGIESPVIVGGTVYLTNSWDWIMAIPLKTISHGS"
FT                   /protein_id="YP_002218499.1"
FT   sig_peptide     33353..33451
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.668 at
FT                   residue 33"
FT                   /locus_tag="Lferr_0030"
FT   misc_feature    33767..>33856
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="Lferr_0030"
FT   misc_feature    33995..>34489
FT                   /note="Dehydrogenases with pyrrolo-quinoline quinone (PQQ)
FT                   as cofactor, like ethanol, methanol, and membrane bound
FT                   glucose dehydrogenases. The alignment model contains an
FT                   8-bladed beta-propeller; Region: PQQ_DH; cl11493"
FT                   /db_xref="CDD:159495"
FT                   /locus_tag="Lferr_0030"
FT   misc_feature    34454..>34801
FT                   /note="FOG: WD40-like repeat [Function unknown]; Region:
FT                   COG1520"
FT                   /db_xref="CDD:31709"
FT                   /locus_tag="Lferr_0030"
FT   gene            34969..36327
FT                   /db_xref="GeneID:6875980"
FT                   /locus_tag="Lferr_0031"
FT   CDS_pept        34969..36327
FT                   /locus_tag="Lferr_0031"
FT                   /gene_family="HOG000072839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_1838 hypothetical protein"
FT                   /db_xref="GI:198282179"
FT                   /db_xref="GeneID:6875980"
FT                   /translation="MGKRKQPKKYAIYAVAVAVLAAGSIDSAAAANWFKLEGISPLQAP
FT                   LLNFSGFFIPLYKYMNGTAAENGQTPRFNLVAPQDTSSKSFNILFAHIMLRGNINKHIS
FT                   YMLAGEFGNNQFTHVGGNYTPQLMDAHATFSYVPGARFEVGIIRAPGPEEDMQGYPNFA
FT                   FGFNYSTVVQQLMLQPFYSTNTNYGSGPYESYSVPGKNIMGNNAFRYPGAEVMDWFRAG
FT                   NMEYAYGVMVGNFGPLVATNTSSGALVAARLQASYILKGFGPIHGPFRSDVTGFLWYQH
FT                   ANPIFNGQSYSMTRDGLGLTYTQGYMHRWGRWLKFEYIRGSGMIDAPAVFNAYAGAAPT
FT                   LTDAQVYPGSQNTAKGYYVSGGFFVTNRLEFDLRYDFYDRLPNVATQERIFKTWAIGGQ
FT                   YHITKSTRIMVDYFVRSVKIPDLSGIPPAQRVLPQSVADAADNEFAVTAFIAF"
FT                   /protein_id="YP_002218500.1"
FT   sig_peptide     34969..35058
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.564 at
FT                   residue 30"
FT                   /locus_tag="Lferr_0031"
FT   gene            complement(36399..37754)
FT                   /db_xref="GeneID:6875981"
FT                   /locus_tag="Lferr_0032"
FT   CDS_pept        complement(36399..37754)
FT                   /locus_tag="Lferr_0032"
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; KEGG: noc:Noc_3086 tRNA modification GTPase
FT                   TrmE"
FT                   /db_xref="GI:198282180"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005289"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="GeneID:6875981"
FT                   /translation="MDYQQGDTIVAIATPPGEGGVGILRFSGPQAPSIATALCGRRSAK
FT                   PLTPRHAHFRRFYARDGSLIDHGIVLYFPAPNSYTGETVVELQGHGSPLALASLLTEAI
FT                   ALGARAARAGEFSERAFLNGRLDLAQAEAVADLIHARSDAQARAAAASLEGAFSQAVDD
FT                   IHGQLLRLLALAEAGLDFSEEDLGDAHAQAISDSLVRLDAQVAHLLKQAQQGARLARGG
FT                   RVVLAGRPNVGKSSLMNALARRESAIVTAIPGTTRDLLREEIILGGLPVELVDTAGLRE
FT                   ATDAVEAEGVARARNILHSAQLILLVADASTGWQSEDEVILRDLPEGPRRIIWNKMDLV
FT                   SAPPATPTGEEAITLSAQTGAGLDTLHCSLIEALGVQGDSCPFSARRRHVEALESCAHR
FT                   LGIAGDTLRLGDAPELVAQSLREAAAALAGITGHMDVEDILGEIFSRFCIGK"
FT                   /protein_id="YP_002218501.1"
FT   misc_feature    complement(36402..37748)
FT                   /note="tRNA modification GTPase TrmE; Reviewed; Region:
FT                   trmE; PRK05291"
FT                   /db_xref="CDD:179996"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(37380..37733)
FT                   /note="GTP-binding protein TrmE N-terminus; Region: TrmE_N;
FT                   pfam10396"
FT                   /db_xref="CDD:150979"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36630..37088)
FT                   /note="TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found
FT                   in bacteria and eukaryotes.  It controls modification of
FT                   the uridine at the wobble position (U34) of tRNAs that read
FT                   codons ending with A or G in the mixed codon family boxes.
FT                   TrmE contains a GTPase...; Region: trmE; cd04164"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(37050..37073)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(order(36681..36689,36741..36743,36747..36752,
FT                   37047..37058,37062..37064))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36978..37028)
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36987..36989)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(order(36855..36899,36903..36935))
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36921..36932)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36741..36752)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   misc_feature    complement(36681..36689)
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133364"
FT                   /locus_tag="Lferr_0032"
FT   gene            complement(37792..39378)
FT                   /db_xref="GeneID:6875982"
FT                   /locus_tag="Lferr_0033"
FT   CDS_pept        complement(37792..39378)
FT                   /locus_tag="Lferr_0033"
FT                   /gene_family="HOG000101822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   noc:Noc_3087 60 kDa inner membrane insertion protein"
FT                   /db_xref="GI:198282181"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR013308"
FT                   /db_xref="GeneID:6875982"
FT                   /translation="MDNQKTILAVALAVVVFLLFQAWQEQNAPKPAAGPAVSRSVTAPG
FT                   ATATSPAPVDVVPASAGGLPPATGAAVSFQTQVFTGRISLNGGDIQNLGLRHYPQAVDD
FT                   TAPYPLLDGAPARLTIQQSGFVSSDGQTLTARFAAPAGQTTAGQPIVLTGKAGPLTVEK
FT                   TWTFQPDSYVAEEHVTITNSGSAPWNGSYFDQILRNDRTETHMFMSIFTGAVLMHQGNF
FT                   SEVSFSDIHDHPVLKSGPGWAGMMDHYFLTAILPSAHAQVQVYARPSGTNYVAGVSTPL
FT                   PTLAPGQSTTITQQLFLGPKRQQTLAAMGRGLEQTVDYGWFAIIAEPMHVVLTWFHGLV
FT                   GNWGLAIILLVIVVKSIFFYPSAISYRSMANMRKLQPKLEKLKQEVGDDRQKLGAAMME
FT                   LYRSEKVNPMAGCLPIILQMPFFIALYWVLVESVSLRQAPFILWIHDLAIPDPYFILPL
FT                   LMGISMFFQQRLNPAPVDPMQKRIMSALPVVFAVFFSFFPAGLVLYWLTNNVVSIGQQY
FT                   LITRHIMKAKD"
FT                   /protein_id="YP_002218502.1"
FT   sig_peptide     complement(39304..39378)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.938) with cleavage site probability 0.694 at
FT                   residue 25"
FT                   /locus_tag="Lferr_0033"
FT   misc_feature    complement(37795..39186)
FT                   /note="membrane protein insertase; Provisional; Region:
FT                   PRK01318"
FT                   /db_xref="CDD:179279"
FT                   /locus_tag="Lferr_0033"
FT   misc_feature    complement(37816..38355)
FT                   /note="60Kd inner membrane protein; Region: 60KD_IMP;
FT                   cl00489"
FT                   /db_xref="CDD:186030"
FT                   /locus_tag="Lferr_0033"
FT   gene            complement(39394..39609)
FT                   /db_xref="GeneID:6875983"
FT                   /locus_tag="Lferr_0034"
FT   CDS_pept        complement(39394..39609)
FT                   /locus_tag="Lferr_0034"
FT                   /gene_family="HOG000231600" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   mmw:Mmwyl1_3004 protein of unknown function DUF37"
FT                   /db_xref="GI:198282182"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="GeneID:6875983"
FT                   /translation="MSVRRAAVVVVRGYQYIISPMLGHNCRFFPTCSEYTCQAIERYGI
FT                   AKGSWLGIKRISRCHPWHPGGVDPVP"
FT                   /protein_id="YP_002218503.1"
FT   misc_feature    complement(39400..39573)
FT                   /note="Domain of unknown function DUF37; Region: DUF37;
FT                   cl00506"
FT                   /db_xref="CDD:186043"
FT                   /locus_tag="Lferr_0034"
FT   gene            complement(39606..39956)
FT                   /db_xref="GeneID:6875984"
FT                   /locus_tag="Lferr_0035"
FT   CDS_pept        complement(39606..39956)
FT                   /locus_tag="Lferr_0035"
FT                   /gene_family="HOG000266301" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease P protein component"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: sfu:Sfum_2595 ribonuclease P
FT                   protein component"
FT                   /db_xref="GI:198282183"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="GeneID:6875984"
FT                   /translation="MNPALAHPHRFTREDRLRQKVAIQRTLKQGRKKVFPELVIYALRN
FT                   ELPHPRLGLAVSRKVGNAVVRNRIKRRLREAFRQQSVRTRGRDVLVVARPSARQLSMRA
FT                   MGAYLQQTLERT"
FT                   /protein_id="YP_002218504.1"
FT   misc_feature    complement(39612..39920)
FT                   /note="Ribonuclease P; Region: Ribonuclease_P; cl00457"
FT                   /db_xref="CDD:186008"
FT                   /locus_tag="Lferr_0035"
FT   gene            complement(39961..40095)
FT                   /db_xref="GeneID:6875985"
FT                   /locus_tag="Lferr_0036"