(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIFD_1

ID   ACIFD_1; SV 1; empty ; DNA; empty ; PRO; 2158157 BP.
XX
AC   NC_013124;
XX
PR   Project: 59215;
XX
DE   Acidimicrobium ferrooxidans DSM 10331, complete genome.
XX
OS   Acidimicrobium ferrooxidans DSM 10331
OC   Bacteria; Actinobacteria; Acidimicrobidae; Acidimicrobiales;
OC   Acidimicrobineae; Acidimicrobiaceae; Acidimicrobium.
XX
RN   [1]
RP   1-2158157
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K.,
RA   Mikhailova,N., Clum,A., Larimer,F., Land,M., Hauser,L., Markowitz,V.,
RA   Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Lang,E., Spring,S.,
RA   Klenk,H.-P. and Eisen,J.A.;
RT   "The complete genome of Acidimicrobium ferrooxidans DSM 10331";
RL   Unpublished
XX
RN   [2]
RP   1-2158157
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (19-AUG-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2158157
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K.,
RA   Mikhailova,N., Clum,A., Larimer,F., Land,M., Hauser,L., Markowitz,V.,
RA   Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Lang,E., Spring,S.,
RA   Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (29-MAY-2009) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001631.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083228
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2158157
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:525909"
FT                   /note="type strain of Acidimicrobium ferrooxidans"
FT                   /strain="DSM 10331"
FT                   /organism="Acidimicrobium ferrooxidans DSM 10331"
FT                   /culture_collection="DSM:10331"
FT   gene            87..1463
FT                   /db_xref="GeneID:8324142"
FT                   /locus_tag="Afer_0001"
FT   CDS_pept        87..1463
FT                   /locus_tag="Afer_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: ace:Acel_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:256370825"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:8324142"
FT                   /translation="MSAPEASWEAIAQAFRTAVGEATWLTWFRTLAPQELSDQQIVLTT
FT                   PSPLAKERLETKYRDVLEDVLTPIMGARVPVAVRVRADVPDETPTTAHSLFDSSPTSSP
FT                   TPSRRNGRGSSSTFDPRYTFEAFVIGSSNRFAHAAALSVAETPARSYNPLFIHGDAGLG
FT                   KTHLLHAIGNYARENYPNLLTTYVSTETFLNEFVDAIKRNQTSEFKARYRACDILLVDD
FT                   IQFLEGKEAIQEEFFHTFNTLYGAQKQIVLTSDRPPRALATLEDRLRSRFAMGLITDVQ
FT                   PPDLETRAAILRRKAEDAGVTVPATVIEFIAASITDNIRELEGALTRLAAFSTLSQTGI
FT                   TLTMAEQVLSDLISQHATQRQRTPAEVIAATAALFNLTPEDITGASRKRPVAVARQIAM
FT                   YVVRELTELSYPEIGRAFGGKDHTTVMHAVSRVQELMQESVEIYEQVDQLFKSLRGPRP
FT                   "
FT                   /protein_id="YP_003108649.1"
FT   misc_feature    108..1451
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    483..914
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    558..581
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    order(561..584,747..749,846..848)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    735..752
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    885..887
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    1176..1433
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Afer_0001"
FT   misc_feature    order(1245..1247,1269..1274,1293..1295,1311..1319,
FT                   1344..1358,1365..1367,1374..1379)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Afer_0001"
FT   gene            1687..2787
FT                   /db_xref="GeneID:8322048"
FT                   /locus_tag="Afer_0002"
FT   CDS_pept        1687..2787
FT                   /locus_tag="Afer_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: rxy:Rxyl_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="GI:256370826"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8322048"
FT                   /translation="MKFLCERDELASALQAASRALSSRSSLAGVRWTLRGGELEVEGRE
FT                   SDLAIRSVLGAMGTEGSFQTPASLAVDLVRTMPSDQVEVVVEDASVVLRSGRAEVSLQL
FT                   LPTLELPGIGEGTTPSATVPAAALAQGIRQVAVAAARDDGRDLIYSSMLFSSTNDGLRL
FT                   VATDGTRLALRDIANLSVAGSEARDVVIPTRAVRELERLVTGAGVDEIHVGIGERDAVF
FT                   VVGTTTLATRLVDEPFRDYRRLVEATYPKKLLLDRLSLVDAMRRLRRMAKEARNSSSIQ
FT                   MNMTPTACELSVRIPSVGQVHEVLDANFNDAEFTINFDPDMLADGVDGVEGDVIRLEFI
FT                   EANRAACVSSADTREYLYILMPIVAR"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003108650.1"
FT   misc_feature    1687..2775
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Afer_0002"
FT   misc_feature    order(1747..1749,1888..1890,1909..1911,2266..2268)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Afer_0002"
FT   misc_feature    order(1891..1893,1900..1902,1975..1977,1981..1983,
FT                   2491..2493,2590..2595)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Afer_0002"
FT   misc_feature    order(2182..2184,2188..2199,2641..2643,2767..2775)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Afer_0002"
FT   misc_feature    order(2182..2184,2188..2193,2416..2418,2527..2529,
FT                   2566..2571,2650..2652,2767..2775)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Afer_0002"
FT   gene            2796..3836
FT                   /db_xref="GeneID:8322049"
FT                   /locus_tag="Afer_0003"
FT   CDS_pept        2796..3836
FT                   /locus_tag="Afer_0003"
FT                   /gene_family="HOG000269558" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sth:STH4 DNA repair and
FT                   genetic recombination protein"
FT                   /db_xref="GI:256370827"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:8322049"
FT                   /translation="MRSLRITGLRNLDLTIDHVPDDIIAVVGSNGHGKTSLLESVSVVL
FT                   AGRSFRTHDRSALVRVGHDEAVVVADVERELAPPVRVGRRVDREGRLETRVDGQREQRG
FT                   PSLPVVSFHPDDVQIASGGPEQRRRFLDECVVGLDRGAAIRLRQAERVLRQRTEALRAP
FT                   VLDEVTLSILEERLARASVEVAELRARAAEVIAPHARAVIDEMLMSAGRVVVTYRGAGD
FT                   EATLLEQLRARRGDDRRRGVTSVGFHRDDVEILLDGEPIRRMGSQGQVRTVVVALKVAL
FT                   ARAMEAVTKEPPVLVLDDLLAELDAERARRAVAMMEGMQAFISHTAPVEGSGFELRISH
FT                   GALVDA"
FT                   /protein_id="YP_003108651.1"
FT   misc_feature    2796..>3311
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Afer_0003"
FT   misc_feature    2877..2900
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Afer_0003"
FT   misc_feature    order(2886..2891,2895..2903,3135..3137)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Afer_0003"
FT   misc_feature    3126..3137
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Afer_0003"
FT   gene            3847..4161
FT                   /db_xref="GeneID:8322050"
FT                   /locus_tag="Afer_0004"
FT   CDS_pept        3847..4161
FT                   /locus_tag="Afer_0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370828"
FT                   /db_xref="GeneID:8322050"
FT                   /translation="MPGPVPIAEVLAKLDTAQRAGVDVVRRGELKTVVREALGPALVRR
FT                   CSLVRLAEDEIVLGAGGAGLVALRGAAARLRVALAEAGYQGELRLVAIPGEPRPWSQLG
FT                   "
FT                   /protein_id="YP_003108652.1"
FT   gene            4247..6190
FT                   /db_xref="GeneID:8322051"
FT                   /locus_tag="Afer_0005"
FT   CDS_pept        4247..6190
FT                   /locus_tag="Afer_0005"
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: ace:Acel_0005 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; DNA gyrase subunit B domain protein;
FT                   TOPRIM domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:256370829"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:8322051"
FT                   /translation="MVDRGRIKSLEPEASYTAADIVVLEGLEHVRLRPGMYIGSTGPSG
FT                   LHHLVWEVVDNAVDEVMAGACTEIDVTILADGGCRVEDNGRGIPVDPHPSDPSKSAAEV
FT                   VLTQLNAGGKFGTGGYKVSGGLHGVGVSVVNALSARLVLEVHRDGSTYRMEFVKGGTPT
FT                   GPLERIGSSGGRRGTVVTFWPDPTIFEDTEFSAQRILERLQVIAFLNKGVVVRFRDERP
FT                   GREHEQTFSYAGGIVDFVRHLNEPKGPLFAKVGYYAASEEDMEVEVAFSWNTTFYETLF
FT                   TFANGISTEEGGMHAEGFRKALTQVINRYARARNLLKERDENLEGNDIREGMTTIVSVR
FT                   LVNPQFEGQTKTKLGNVSVRSFVERVTNEHLATWLEENPREAQAIVQKAIVAQRARLAA
FT                   RQARELTRRKSGLESAGLPGKLTDCTSRDPSESELFIVEGNSAGGTTIKGRDPKTQAVL
FT                   PIRGKILNVERARLDKMLSNQEIQSLIAAIGAGVGDEFDIKKARYHKVIILADADPDGS
FT                   HIRTLLLTFFFRQMRPLVEAGMVYAAQPPLYSTLLGTEKVYIKNEAERLRFLEAHPNHK
FT                   KPFLRLKGLGEMDFDELRDTTLHQDRRTLLKVTIEQAAIADEVCSVLMGDDVEQRRRFI
FT                   QENAGDARFIDF"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003108653.1"
FT   misc_feature    4292..6184
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    4373..>4519
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    4946..5389
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    5099..5101
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    order(5273..5275,5282..5287,5291..5293)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    order(5291..5293,5297..5299)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    5540..5881
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    order(5558..5563,5570..5572,5777..5779,5783..5785,
FT                   5789..5791)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    order(5558..5560,5777..5779)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Afer_0005"
FT   misc_feature    5987..6154
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Afer_0005"
FT   gene            6222..8672
FT                   /db_xref="GeneID:8322052"
FT                   /locus_tag="Afer_0006"
FT   CDS_pept        6222..8672
FT                   /locus_tag="Afer_0006"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_2704 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:256370830"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:8322052"
FT                   /translation="MPDEPTPDASNVELIELQEEMERSFLEYSLSVIIARALPDARDGL
FT                   KPVHRRILYSMYDAGYRPDRPHVKCAKVVGDVMSRFHPHGDAAIYDALVRMAQDFSLLH
FT                   PLIDGHGNFGSPDPSTGPAASRYTECRLAPIALELLAGIDEDTVDFVPNYDSQTVEPSV
FT                   LPARFPNLLVNGSQGIAVGMATQIPSHNLGEVVDAIAYLIDHPEATVDELMRFVPGPDF
FT                   PTGGIILGRDGIRDAYRTGRGSVKLRAVATIEEARSGYQIVVTEIPFQTSVEVIADKIR
FT                   HLVEEKLLEGIRDMKNFSAGSETRFVIELKRDANPNVVLNNLYRLTPLQTSFPIQMLAL
FT                   VDGAPRTLNLLGLCQIYVDHQREVIRRRSEFRLGKARERLHIVEGLLSCIDQLDAVIAT
FT                   IRASEDRAAARAALMAEPFGFSELQANHILDMTLGRLTRLGREELEEEAATLRATIAEL
FT                   EAILADAQRLSAVVKDEMLAATAEYRQARRTRFEVDPGDFAAEDLIEDEPIVVLISRSG
FT                   YIKAVPESSFKAQGRGGRGVVGARVKDEDEIAHVISSSMLSRLLVFSSRGRVYQLRGYE
FT                   LPKLERSARGTALVNLVPLADDERITSVMGTKDFPEDADLVFFTRNGMVKRTAMAEYAR
FT                   SRRDGIIAIDVRGDDELVSVVVATEEHDGVVFTKRGQVLRFPLAEVRRTGRATAGVRSI
FT                   RRADGDWIVAGGLIEDGVEVLLVTSRGYGKRTPLDSFPVHHRGGAGIRGIGLTERKGEL
FT                   VAAAFVRPEDEVLIVSSQGQMIRVRIGDISNQGRYATGVKLISLQAEESVASVGVVPES
FT                   GTDA"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003108654.1"
FT   misc_feature    6222..8666
FT                   /note="DNA gyrase subunit A; Validated; Region: PRK05560"
FT                   /db_xref="CDD:168095"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    6321..7655
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    order(6321..6404,6417..6566,6570..6578,6582..6629,
FT                   6633..6704,6711..6713)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    6600..6602
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    order(7392..7400,7407..7418,7443..7448,7497..7547)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    7899..8048
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    8058..8201
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    8214..8333
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Afer_0006"
FT   misc_feature    8505..8654
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Afer_0006"
FT   gene            8721..9707
FT                   /db_xref="GeneID:8322053"
FT                   /locus_tag="Afer_0007"
FT   CDS_pept        8721..9707
FT                   /locus_tag="Afer_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: glycosyl hydrolase, family 18, putative ;
FT                   K01183   chitinase"
FT                   /db_xref="GI:256370831"
FT                   /db_xref="GeneID:8322053"
FT                   /translation="MARWTARWLLQVASTVAMAGVLAVVPGARGSGTKTLTGSQVSWSI
FT                   AWVPASVPSVALPSVSFASFEDPTNPTEGPQPTFPHPNIATPEGAALSVGQPIIVAPQT
FT                   SELGTTLSGSATVAGGIVVTVTVNGVAEPPVTVSNVASYAMSWQASVEDVYVSAGTVPA
FT                   SAPILAGTNVLAPTANDVTPTGSLAPGTFGSLCDAGAVSASSDLFSRLTPALAQSAAGK
FT                   LSPLVSTPTSEDPGTCAIEFAAPSGLSGGSTWTVNAQLAAAFTATATARLQTVHLSVDG
FT                   VAVTIPGGTYSDVTLDVPPWVLGPATSIDEQVATVESLPVGAAVFGG"
FT                   /protein_id="YP_003108655.1"
FT   gene            9712..11214
FT                   /db_xref="GeneID:8322054"
FT                   /locus_tag="Afer_0008"
FT   CDS_pept        9712..11214
FT                   /locus_tag="Afer_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sco:SCO4526 protein kinase"
FT                   /db_xref="GI:256370832"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:8322054"
FT                   /translation="MATIAPGVGRTESLAPRSLAELIERGPFERYLRETLTWSLVSRFL
FT                   VDAQRHADDERQAAEFDHWHERYRALFSRAADEVLQTVSQEMLDHLSVLEKRAAFNANY
FT                   VAIGERIRTLLQARPDADEIQRLPNVGPLLTIRLYGEMFDLGIVLLYYFASEVENIHIV
FT                   DERVTVYTSDGRAWLSMIDAAADGRALKDRGAQFAQISGGGVPQRFDPVHHAPNLTSPY
FT                   GIRMALRQRTTRSGEFLAALRLHHATNITFDALIEQGVLSEEAGLMLAQAVRAAVPILI
FT                   AGAPGSGKTTLLRALTKFIPRAEPVLVAENYEELHLEELVDDRGRPWFYVLHSHVEQEA
FT                   NAEGAGSVTMKTILERGLQEDVRRLVIGEVTDPETMEVLLQAANTGTSGVLATIHAESA
FT                   LDTVNRVFGLLLRTTRYTDRAAAYLIESTLNLVVHCALVRNEQSRRRVVTGIGWVVPHP
FT                   GQVGGMPRMQMAFVREGSALVRAVDHANVAHRLEELVARRRS"
FT                   /protein_id="YP_003108656.1"
FT   misc_feature    <10192..>10644
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Afer_0008"
FT   misc_feature    10468..11055
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Afer_0008"
FT   misc_feature    10543..10962
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Afer_0008"
FT   misc_feature    order(10558..10563,10573..10581)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Afer_0008"
FT   misc_feature    order(10561..10563,10573..10581,10633..10635,10639..10644,
FT                   10813..10818)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Afer_0008"
FT   misc_feature    10801..10815
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Afer_0008"
FT   gene            11311..11580
FT                   /db_xref="GeneID:8322055"
FT                   /locus_tag="Afer_0009"
FT   CDS_pept        11311..11580
FT                   /locus_tag="Afer_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370833"
FT                   /db_xref="GeneID:8322055"
FT                   /translation="MGRRMVRGAAWWLASVVRSVMAVVTGGPAALVSLASDESGAETSV
FT                   ATIAWVVLGLIVVAFVVFLVFQFTGSATSAASNTNNQLSTLPQG"
FT                   /protein_id="YP_003108657.1"
FT   gene            11586..11957
FT                   /db_xref="GeneID:8322056"
FT                   /locus_tag="Afer_0010"
FT   CDS_pept        11586..11957
FT                   /locus_tag="Afer_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370834"
FT                   /db_xref="GeneID:8322056"
FT                   /translation="MFARRLLVDEQATSTVVGPVVVVVFLMLIALTIGFGALWVGHVEA
FT                   VWGAEAIAADLGIGGSPAQGFAFGVLRDVTWSIQPVSVSGPDAPGAASMVVVHADLGGL
FT                   VPVTSQVALQPPSQLGTGA"
FT                   /protein_id="YP_003108658.1"
FT   gene            11957..12382
FT                   /db_xref="GeneID:8322057"
FT                   /locus_tag="Afer_0011"
FT   CDS_pept        11957..12382
FT                   /locus_tag="Afer_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GK18624"
FT                   /db_xref="GI:256370835"
FT                   /db_xref="GeneID:8322057"
FT                   /translation="MRRLLTDDRAESDAVVALPAVAAVMVVLAVSVGVVVWWAAAQSAQ
FT                   AIANAAGFEALSLPVLGTPAAESALGAMVAAETAARSFPPLSCALSGLDVAAAQIPASV
FT                   TVTVTCSTTVPVLGFVHFERSVTLGLNPSHLIAGSTP"
FT                   /protein_id="YP_003108659.1"
FT   gene            12379..12861
FT                   /db_xref="GeneID:8322058"
FT                   /locus_tag="Afer_0012"
FT   CDS_pept        12379..12861
FT                   /locus_tag="Afer_0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370836"
FT                   /db_xref="GeneID:8322058"
FT                   /translation="MRAPSEQGDATPALLAVGSILLVMGLTVAALVLESITMAETMARA
FT                   AARAAAHAAANVLWQTAGNAGSPGLVTMRNPSFYDPNLQSAASAALAGVPHGVGTSVVS
FT                   CSGGLVPNGHGLQRYYLDVRATCTVVFVPPMSDLITVVAISPITVTASAHLVGSLA"
FT                   /protein_id="YP_003108660.1"
FT   gene            12858..14492
FT                   /db_xref="GeneID:8322059"
FT                   /locus_tag="Afer_0013"
FT   CDS_pept        12858..14492
FT                   /locus_tag="Afer_0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: saq:Sare_5011 Na+/solute symporter"
FT                   /db_xref="GI:256370837"
FT                   /db_xref="GeneID:8322059"
FT                   /translation="MSARRVAIGLAGSIAEVLVLTPWSLPNERVVAHPVVVGAAAVCAI
FT                   AALALWWRWVLGRGGGDHSSIPDGVRAPARASVAVDLDLDAVPAIEVPGVGIVAMERST
FT                   SQWVLEVAAEQELHRVAEHARLHRPRGMVPLAVPDRNPAAEDLRALVRLDHRVRSSPAH
FT                   EGSLTPLRSGEVVGGQRHTHADAGSACIRVVDRLGQLRVLSGLVGIEPGTGLDLIVQHR
FT                   LLPWLEPVRCVVVGMRREEVVALARSSVLVVSDIRRAQAVLDEAVSATNGFPVLVVVHG
FT                   VRLAMDDVRALGAAGRVVVVETSGPPDVSFASIDRGRWHGAVERLSTFAPTPLLPGQLP
FT                   PPPRPGRPWVRLCGLEPRLEGVAASRDAAQLVAALVLDGGRATIDALADALERPARTVR
FT                   SLAREVPTCVDDERDGLRLRPGVGSDLGLVHRVDEAIRIVDLVARPPLAAYEQPWFRAR
FT                   APVLEAVLVDSLLATAEALERADARGEAKVIVRLVRRTFGPLERLEGGGLRPDGTTGAD
FT                   EGVARSEEVGTHVPRAALVRPGAVGSW"
FT                   /protein_id="YP_003108661.1"
FT   gene            14486..14986
FT                   /db_xref="GeneID:8322060"
FT                   /locus_tag="Afer_0014"
FT   CDS_pept        14486..14986
FT                   /locus_tag="Afer_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370838"
FT                   /db_xref="GeneID:8322060"
FT                   /translation="MVSSFDERQPSALGWEGVDQAPSTGLSETDQHVFWVEVGDRIGEG
FT                   LGLITARSEVAEVELIVGPGDEHRTVAEPVGGAPSNWGDFGDLGGVARDDRDDEPRRLV
FT                   VAATEPTAETGTVAAVDVVTAPLMTRPRRSRWRTWSMVLASVALIVAARLLLFVATTGG
FT                   RHP"
FT                   /protein_id="YP_003108662.1"
FT   gene            14983..15468
FT                   /db_xref="GeneID:8322061"
FT                   /locus_tag="Afer_0015"
FT   CDS_pept        14983..15468
FT                   /locus_tag="Afer_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cak:Caul_4339 peptidase M28"
FT                   /db_xref="GI:256370839"
FT                   /db_xref="GeneID:8322061"
FT                   /translation="MIAAVWLLAGVGVMGAHLVGPGREDARSHRLRRRGSLWIVTLVSA
FT                   LYAVAGLALGFEPLGWLPLALGLWLILVVAFVVLFQRRHVGGADVRYVGGALWLVAVGL
FT                   GPVGLVWLPLTLLGASLAQLAWSAISGQRGPWAMVAWLSAAGLVLAVVALIAEVALR"
FT                   /protein_id="YP_003108663.1"
FT   gene            15525..16175
FT                   /db_xref="GeneID:8322062"
FT                   /locus_tag="Afer_0016"
FT   CDS_pept        15525..16175
FT                   /locus_tag="Afer_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GK12395"
FT                   /db_xref="GI:256370840"
FT                   /db_xref="GeneID:8322062"
FT                   /translation="MARDDAARRLVITGVGIAFLGLAIAGTSVYYLETRVFREVQIVEA
FT                   AAELLPGQPIARSELTVVTTPAQIASGSGVVLAGALDALSSGSYTVSVPVAPGAPLEVR
FT                   ELAKRPPRGERVLYFTPQVAPPNLEAGSVIDILVPQPSTVQTQSSAHVPYDVPVATGVT
FT                   VLSVTHPSSGSSGSLGIEVALPPAEVAAAAAAATSSQCVVVFSFPGARPVPVG"
FT                   /protein_id="YP_003108664.1"
FT   gene            16178..16954
FT                   /db_xref="GeneID:8322063"
FT                   /locus_tag="Afer_0017"
FT   CDS_pept        16178..16954
FT                   /locus_tag="Afer_0017"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dvu:DVU2710 hypothetical protein"
FT                   /db_xref="GI:256370841"
FT                   /db_xref="GeneID:8322063"
FT                   /translation="MLVVFGLDANVGRKRVAAALTRAVPGTRLLVELGVSGTTWSMAGA
FT                   EFQKRTPTLETIYEVLRERNDGMRRVRVHLDTVVGALSDLESARPISAADASRRDVVPV
FT                   VRAPVSSTEAAERALEFGSALVELFVQLERSSVLGPTTVLADAGWVAPGLVGQAAWAAA
FT                   ASDLVLVVGERPVAIASLGYFERAFPQARVWVVALAAGRRRRRLAEVARFALRARHGVE
FT                   VIAVEPDQLGSGTALEQVLEPIVMGSAGSTLGELGA"
FT                   /protein_id="YP_003108665.1"
FT   gene            16951..17850
FT                   /db_xref="GeneID:8322064"
FT                   /locus_tag="Afer_0018"
FT   CDS_pept        16951..17850
FT                   /locus_tag="Afer_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370842"
FT                   /db_xref="GeneID:8322064"
FT                   /translation="MTRALVMIAGSFLGIGVVGALIAIAVALRPPSGGRVEEVERVGLV
FT                   SRRPSALRSALATMHPFAIDHRLAIGVALALLAGLAGAWLLVVPSILIGYVLGDLFLRP
FT                   ALAESVDELSSMLQFIIDFRSGLLSGGVSVPAALELAIDAQPAGRFTRDRRVPYQQMAD
FT                   PSAREGEARVALSHLIERTTNPLIHITDVLVYLALRATNLRVANQLDLLGDVLLQQVQA
FT                   YRGLVVTELLSSLGEVRLITIITIGAVYATLLALGGSLGSDIGLSLLAQVVALAGSGAQ
FT                   LLWALSLRRDLEFKLRYL"
FT                   /protein_id="YP_003108666.1"
FT   gene            17862..18785
FT                   /db_xref="GeneID:8322065"
FT                   /locus_tag="Afer_0019"
FT   CDS_pept        17862..18785
FT                   /locus_tag="Afer_0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="GI:256370843"
FT                   /db_xref="GeneID:8322065"
FT                   /translation="MDARWLIIGVGIAIGLVIAGAGVALAGGSTLLALRRYAAALPSIA
FT                   SRSRVPLARRVVAALARRQADFDATLWIAHWSTEDAVARLQQLWLVLAVLAGGLVLLAK
FT                   AVVPNLSPFVLAIVAAAALALAAVVARVVLVWQVRAEARIARQRIDNSLANLALLIRVY
FT                   VQGGASATEALTAISELRGVMSDAGARDVDAWIQGSQRNDQNIGAVLERFGNTYGVPRI
FT                   AQLGSYLEQSILSGRPVSDTLDVAIRDAYQALFESTVAAVNQRVRIASLVFIPGVIAIG
FT                   VVFMASMIASMHGIGQVTKLFGGGGL"
FT                   /protein_id="YP_003108667.1"
FT   gene            complement(18791..20422)
FT                   /db_xref="GeneID:8322066"
FT                   /locus_tag="Afer_0020"
FT   CDS_pept        complement(18791..20422)
FT                   /locus_tag="Afer_0020"
FT                   /gene_family="HOG000221633" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.14"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.14"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_3218 putative glycosyl hydrolase
FT                   family protein; PFAM: Carbohydrate-binding family V/XII;
FT                   SMART: Carbohydrate-binding family V/XII"
FT                   /db_xref="GI:256370844"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="GeneID:8322066"
FT                   /translation="MSHDELSPLGDHSLQPLITVSDLVMPHELEGDGPDRKPPLGERLR
FT                   RYSPVRILMGLMVLGGAGSLAAWRIHQRIIDAAPVHATYFAPYVDATLSPTYAFQDPTQ
FT                   NDAKQTVLGFVVASGTNGCSPTWGGVYTPSAANQDLALNSRLAEYASIGGTAIVSFGGQ
FT                   AHTHLSMACTTPTSLAAAYQQIIRQYDQHIVDFDIEGPALTSQAATLRRAAALSIVAHE
FT                   DPGIQIWLTLPATPQGLSDPGIAAIRAMLLKRVPLAGVNVMTMDFTSTPGGLVQTAESA
FT                   LTAAHQQLTTLFAEYRIPLNSHQIWNHMGVTFQIGQNNVVGQRVSLQGASQLVAWSTSQ
FT                   AIGRVSFWSLNRDAPCAASLANEAVYSNTCSDAQTAPLAFSSEIEHQIPASVQRGRGLI
FT                   QVTTTVSANPANAPFPIWSASFPYPAGYKVVWGGYIYEAKWYNQGQQPTQQFEYAYQTP
FT                   WELLGPVLESDHAPTLPTLPPGADPTWEPTVTYQPGQVVEFEGLPYQAKWANQAQSPAS
FT                   AMADPTISPWQPLWSYPGEPPLTATN"
FT                   /product="Chitinase"
FT                   /protein_id="YP_003108668.1"
FT   misc_feature    complement(19280..20176)
FT                   /note="PF-ChiA is an uncharacterized chitinase found in the
FT                   hyperthermophilic archaeon Pyrococcus furiosus with a
FT                   glycosyl hydrolase family 18 (GH18) catalytic domain as
FT                   well as a cellulose-binding domain.  Members of this domain
FT                   family are found not only in...; Region: GH18_PF-ChiA-like;
FT                   cd06543"
FT                   /db_xref="CDD:119360"
FT                   /locus_tag="Afer_0020"
FT   misc_feature    complement(order(19379..19381,19481..19483,19625..19630,
FT                   19826..19828,19832..19834,19838..19840,19946..19948,
FT                   20081..20083,20159..20161))
FT                   /note="active site"
FT                   /db_xref="CDD:119360"
FT                   /locus_tag="Afer_0020"
FT   misc_feature    complement(19082..19180)
FT                   /note="Chitin/cellulose binding domain. Putative
FT                   carbohydrate binding domain found in many different
FT                   glycosyl hydrolase enzymes. May occur in tandem
FT                   arrangements; Region: ChtBD3; cl00046"
FT                   /db_xref="CDD:153475"
FT                   /locus_tag="Afer_0020"
FT   misc_feature    complement(18869..18976)
FT                   /note="Chitin/cellulose binding domain. Putative
FT                   carbohydrate binding domain found in many different
FT                   glycosyl hydrolase enzymes. May occur in tandem
FT                   arrangements; Region: ChtBD3; cl00046"
FT                   /db_xref="CDD:153475"
FT                   /locus_tag="Afer_0020"
FT   misc_feature    20600..23706
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|251794552|ref|YP_003009283.1| Glycosyltransferase-like
FT                   protein probably involved in cell wall"
FT   gene            20600..22321
FT                   /db_xref="GeneID:8322067"
FT                   /locus_tag="Afer_0021"
FT   CDS_pept        20600..22321
FT                   /locus_tag="Afer_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AAur_3217"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_3217 hypothetical protein"
FT                   /db_xref="GI:256370845"
FT                   /db_xref="GeneID:8322067"
FT                   /translation="MVGGLRSVSYEHGRENRLSRQPAGTHGQRAQVRLVGQAAQVPESR
FT                   IVTARLAIMTTIGGWVGYLIYWFYSQFLRQGAYTTQAKAEAIAYLAMITLLEASSLAYL
FT                   VARLGHIYRAREHRRVPRAHLDGYFWQRRPSLTMIIPSYREETRVIRNTLLSAALQEYP
FT                   DKRIVLLIDDPPNPTEERHRVLLEAARSLPSQLESLLAYPATAARRAYDEFRERVGSRV
FT                   SQLPAIVHEGGSDSGAAWDGVVVDPSELEQLADTYALAASWLTLQSEELPIIDHTDEFL
FT                   RDEVFVRLAHEFAQIADTLREGASYGREVDAARLAQLYERLLNVFGARITSFERKLYAS
FT                   LSSEPNKAMNLNSYIGLMGGAYSVHRTLSGQVLVSDDPEHADLVIPDPDYVLTLDADST
FT                   LLPEYCLRLVYLMEQEAYAHVAVAQTPYSAYPGPASRLERIAGATTDVQHVVHQGLANY
FT                   RAGFWVGANAVIRKRALNSLEEITWEGGYPIKRYIRDRTAIEDTESSVDIVAQGWEIYN
FT                   YPERLSYSATPPTSVPCASSVAVGLMAACSSCRSCGVTTSGPRRPGVSRSPSSSSA"
FT                   /protein_id="YP_003108669.1"
FT   misc_feature    20831..>21187
FT                   /note="Glycosyltransferases, probably involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane];
FT                   Region: COG1215"
FT                   /db_xref="CDD:31408"
FT                   /locus_tag="Afer_0021"
FT   misc_feature    21014..>21139
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Afer_0021"
FT   misc_feature    order(21020..21022,21026..21028,21107..21109)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Afer_0021"
FT   misc_feature    <21758..22189
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Afer_0021"
FT   gene            22318..23706
FT                   /db_xref="GeneID:8322068"
FT                   /locus_tag="Afer_0022"
FT   CDS_pept        22318..23706
FT                   /locus_tag="Afer_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /codon_start="1"
FT                   /product="diguanylate phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: EAL domain protein; SMART: EAL domain protein;
FT                   KEGG: bln:Blon_0041 hypothetical protein"
FT                   /db_xref="GI:256370846"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:8322068"
FT                   /translation="MNYLASITWTTVALVVLLVFPFANELVSPWIAVLALPYFFAMSTD
FT                   LKYAGYHRRDIFSIYGFNLILVMVNLAGTVSSIGQAVTGARASFARTPKVRKRTVTPLM
FT                   FVVAPYALVVLSIYTLLHDWEHHALNSMLFAAINLVLAAVAIVAFIGVRNSIQDVWIQI
FT                   LPWFQRRTKNRPVRTTRHQEVPVGVGGTQLGTWEHVLDLGASSIGLGEAVDTDGPGRLR
FT                   VGSRAERERARRRLADYGLSALAQPIRDIEADEIVGYEIYQRVNGEAPPAQLARLDTVE
FT                   AASLEQRLLERAALLARDIPEGAWLSVNVSSRFLTLMEGRRRFSLTAREGLFLDVSFTG
FT                   VLDGPHVAATEDTLSRATNRFAIALDDFVPDAGSLAVVRRVRPSMVKLDPDWVHDLPKS
FT                   AAKRGQTELLLRLAAPRTLVVAEGVEDERELAALRALGVRFAQGYLLGRPVPLEETKSI
FT                   APRD"
FT                   /protein_id="YP_003108670.1"
FT   misc_feature    23023..23679
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Afer_0022"
FT   gene            complement(23703..25091)
FT                   /db_xref="GeneID:8322069"
FT                   /locus_tag="Afer_0023"
FT   CDS_pept        complement(23703..25091)
FT                   /locus_tag="Afer_0023"
FT                   /gene_family="HOG000253344" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02692"
FT                   /codon_start="1"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tRNA adenylyltransferase; metal dependent
FT                   phophohydrolase; PFAM: Polynucleotide adenylyltransferase
FT                   region; metal-dependent phosphohydrolase HD sub domain;
FT                   KEGG: sgr:SGR_3683 putative RNA nucleotidyltransferase"
FT                   /db_xref="GI:256370847"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR014065"
FT                   /db_xref="GeneID:8322069"
FT                   /translation="MLPALLRPLIEALRPLAARFDERQRHLYLVGGVVRDALLGIEPNG
FT                   DVDATTDATPEEIVEIVRPVATHFNLTGLRFGTVAFHYHGVPLEVTTHRGEAYDSSTRK
FT                   PTVHFVSALAEDLLRRDFTVNAMAVEVTSDDPTLIDPFGGMEDLLARRLRTPMDPRRSF
FT                   SDDPLRMLRCARFIARLDLEPQRALVDAVHELAPRLEVVSRERIRDELSRLLVVPDPSK
FT                   GLWFLVDTPLAAEFLPELPALRLEQDPIHHHKDVLAHTIAVTASCSPRLRLRLAALLHD
FT                   IGKPATREIGPNGVSFHFHDVVGARMARRILRELRYPNDLVDDVARLVELHLRFHTYAQ
FT                   GWSDAAVRRYVRDAGELLEDLNELTTCDATTRNERRRRMFAERMATFEERARELAERDA
FT                   LRARRPPIDGLEVMRILEIPPGPAVGRAMRFLTDLTIDEGLNDPDEARRRLLEWWRSHS
FT                   GEEA"
FT                   /protein_id="YP_003108671.1"
FT   misc_feature    complement(24648..25076)
FT                   /note="Nucleotidyltransferase (NT) domain of ClassII
FT                   CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="Afer_0023"
FT   misc_feature    complement(23730..25067)
FT                   /note="tRNA adenylyltransferase; Region: tRNA_CCA_actino;
FT                   TIGR02692"
FT                   /db_xref="CDD:131739"
FT                   /locus_tag="Afer_0023"
FT   misc_feature    complement(order(24717..24719,24726..24737,24810..24812,
FT                   24825..24827,24864..24866,24948..24950,24954..24956,
FT                   24984..24989,24996..25001))
FT                   /note="active site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="Afer_0023"
FT   misc_feature    complement(order(24717..24719,24729..24737,24948..24950,
FT                   24954..24956,24987..24989,24996..25001))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="Afer_0023"
FT   misc_feature    complement(order(24825..24827,24948..24950,24954..24956))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="Afer_0023"
FT   misc_feature    complement(24114..>24254)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Afer_0023"
FT   gene            complement(25103..26134)
FT                   /db_xref="GeneID:8322070"
FT                   /locus_tag="Afer_0024"
FT   CDS_pept        complement(25103..26134)
FT                   /locus_tag="Afer_0024"
FT                   /gene_family="HOG000225183" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /codon_start="1"
FT                   /product="histone deacetylase superfamily"
FT                   /transl_table="11"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   sul:SYO3AOP1_1212 histone deacetylase superfamily"
FT                   /db_xref="GI:256370848"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="GeneID:8322070"
FT                   /translation="MGRILYATHERFLEHDAGAWHPERAERLEVVRHALSHFEDAVTIV
FT                   TPTPAPRAAIEAVHTPAHVEALERYCLMGGGPIDPDTSVNDASFEAAQLAAGAGLDAIE
FT                   RLRQGEADAAFLAVRPPGHHATVDQAMGFCLLNNVAIAAQALIDQGERVLILDIDAHHG
FT                   NGTAAIFEREPRVLYVSTHQYPLFPGTGRIGDVGDGPGVGTTINLPLPPQTSGQTARAL
FT                   LETIALPAITTFGPTWAIVSAGYDAHRDDPLTELDFRAPDYAPLIAIARDAVPPGRLIL
FT                   ALEGGYDLEALEHSTLVTFATLLHAAVDVGEAPSRDVDHELVTTLQRLHRAALERGLAN
FT                   ERG"
FT                   /protein_id="YP_003108672.1"
FT   misc_feature    complement(25181..26134)
FT                   /note="Deacetylases, including yeast histone deacetylase
FT                   and acetoin utilization protein [Chromatin structure and
FT                   dynamics / Secondary metabolites biosynthesis, transport,
FT                   and catabolism]; Region: AcuC; COG0123"
FT                   /db_xref="CDD:30472"
FT                   /locus_tag="Afer_0024"
FT   misc_feature    complement(25223..26110)
FT                   /note="Histone deacetylase domain; Region: Hist_deacetyl;
FT                   cl02986"
FT                   /db_xref="CDD:174744"
FT                   /locus_tag="Afer_0024"
FT   gene            26239..26946
FT                   /db_xref="GeneID:8322071"
FT                   /locus_tag="Afer_0025"
FT   CDS_pept        26239..26946
FT                   /locus_tag="Afer_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cau:Caur_1705 GCN5-related N- acetyltransferase"
FT                   /db_xref="GI:256370849"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:8322071"
FT                   /translation="MQVAGRSVRLSPWYGFDGAVLLGLAPALWLRDPAWLDIARRAAAA
FT                   RGWRRFLVQATTPAQRLALDAAGWVLVDELYVLFRRGSLELPPVPHTARGVEMRRGRAA
FT                   DTAELLEVDHRCFEPFWMMNEAALREALQATPRTRFRVLASADDDRVVGYAIFGLGAGE
FT                   GYLQRIAVDPRYQGRGLATRLIVDGLRWAKRWRARRVGVNTQRSNETALRLYQRLGFEM
FT                   EPNGITIYAWPDH"
FT                   /protein_id="YP_003108673.1"
FT   misc_feature    26551..26901
FT                   /note="ribosomal-protein-alanine acetyltransferase; Region:
FT                   rimI; TIGR01575"
FT                   /db_xref="CDD:162430"
FT                   /locus_tag="Afer_0025"
FT   misc_feature    26677..26838
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Afer_0025"
FT   misc_feature    order(26743..26751,26779..26784)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Afer_0025"
FT   gene            26927..28705
FT                   /db_xref="GeneID:8322072"
FT                   /locus_tag="Afer_0026"
FT   CDS_pept        26927..28705
FT                   /locus_tag="Afer_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GF17743 gene product from transcript GF17743-
FT                   RA"
FT                   /db_xref="GI:256370850"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="GeneID:8322072"
FT                   /translation="MPGRITSRLVLLLALVVLGVWLPRGAALVSTAREAVTVVSAPGVV
FT                   VGSQPIAATFRLAHRLHDAEAFFVVYPATTSVSGLGAVLSGAQLGYPIGITHAVAVSPH
FT                   ASQMHLVVPDPIPASGCGTSCSGVYPVQLRVASAVSGQTLASVTFAVPYFSTLSGVVPL
FT                   HLAVGVIAETPAVTASAIEELLARDPSVQVGVSAEGPVGLGALRSLAHAVPLRASLLAP
FT                   TVGVARACVGALGPLSSFASSVQLARTVVGTASAPLAFATVPTSDELESLRALGIHEVI
FT                   LPASALASASPVLTLSNAVRLGAGVVALGTSAMVSDGLSSVTQPLGAQLLMAELAQVYF
FT                   EAPSRPGRVLAGLVAVASDARMAAFARGLASLGSLPFLQLSTIDGAMATASSTVVRPNV
FT                   AAERACPRPLEALRVAARRAAALAEAAPGVRPELTALVLGALAHPEASQLARHAIDRTL
FT                   DAITVASDQLTLTSARETVPIDITSHLSVPASIRVVLVDTKLRFPEGSTRTVTVASKTV
FT                   TVPIPVVARTLGTSPLLVRLESPSGQLIGQNVLVVDSTGFSVVGVVLTGSSAALLAVWW
FT                   VRNRGRRQRGRHAKRS"
FT                   /protein_id="YP_003108674.1"
FT   gene            28705..30312
FT                   /db_xref="GeneID:8322073"
FT                   /locus_tag="Afer_0027"
FT   CDS_pept        28705..30312
FT                   /locus_tag="Afer_0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /codon_start="1"
FT                   /product="integral membrane protein MviN"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; multi antimicrobial
FT                   extrusion protein MatE; KEGG: fal:FRAAL6865 hypothetical
FT                   protein"
FT                   /db_xref="GI:256370851"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="GeneID:8322073"
FT                   /translation="MVQARLVRLLAGRGRSVGENATAMAIGTAASRLSGFVRLIVLAVV
FT                   LGVRPLADAFNLANNTPNMLYDLLLGGVISSTILPVVAARIARAGERAGERSLAAIMTI
FT                   GVVGLLVATVLFEVLAPAVVDLYLIGDHLAAAGTERAVAIELLRLFAPQLFFYGTISLA
FT                   TAALNLRGNFAAPAFAPIANNVVAIAVLVAFRVADGSATLDEVASRPDAVLLLGLGTTL
FT                   GVAAQLGVLMPVMARLGLGLRPRLRVSDPAVREVVSLSGWTAGYVVANQVALFVVLALA
FT                   ATRAGYVSAYNYAYLFFQLPYAVVSLSVMSALQPRLARSWAAGDRARFRRDLAKALAVG
FT                   VGATIPLAVLAWVGGPAGLDLLVGYGAVNEHGVALIAGALRGMAVGLPGFSLFLMLIQA
FT                   LQAMRNARAAFVAYLVENGLNIVLAVVALGPLGVEGLGLALGLAYTIGAIVAIVIVRSL
FT                   RGLGPIAPLLGSWVQLAVASVVGGAVLAALLPSTLVAPNLGFALRVLGGLVAGVVVFGA
FT                   AVIGLRTIRVAVARGVGR"
FT                   /protein_id="YP_003108675.1"
FT   misc_feature    28828..29967
FT                   /note="MviN-like protein; Region: MVIN; pfam03023"
FT                   /db_xref="CDD:111867"
FT                   /locus_tag="Afer_0027"
FT   misc_feature    29566..29967
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Afer_0027"
FT   gene            30309..31151
FT                   /db_xref="GeneID:8322074"
FT                   /locus_tag="Afer_0028"
FT   CDS_pept        30309..31151
FT                   /locus_tag="Afer_0028"
FT                   /gene_family="HOG000039326" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /codon_start="1"
FT                   /product="degV family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: hau:Haur_0363 DegV family protein"
FT                   /db_xref="GI:256370852"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="GeneID:8322074"
FT                   /translation="MSVVVVADSASDLPAGVAEALGVQIVPLTIEVGGRDWADGTELPR
FT                   ERFWELQAAQSELPKTAAPSSAQFAAVFERALGEGAEGVVAITLTRKLSATFQAAEHAS
FT                   RDYGGRVRVIDSETLTLTEGLIVEEAARLAASGADLEEVAAAVEDVKTRARTRGTLDTL
FT                   ENLRRGGRIGAAAALLGTVMSFKPMIDITDGEVKPGGRQRTRRRAIDDLVDWVEGLGPL
FT                   TRLGVVHALADDVDEVVERVARAAAVDPATVAVAVMGATIGTHAGPRALGVSALVASR"
FT                   /protein_id="YP_003108676.1"
FT   misc_feature    30345..31127
FT                   /note="Uncharacterized protein, DegV family COG1307;
FT                   Region: DegV; cl00577"
FT                   /db_xref="CDD:163881"
FT                   /locus_tag="Afer_0028"
FT   gene            31219..31545
FT                   /db_xref="GeneID:8322075"
FT                   /locus_tag="Afer_0029"
FT   CDS_pept        31219..31545
FT                   /locus_tag="Afer_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370853"
FT                   /db_xref="GeneID:8322075"
FT                   /translation="MATFETGGEQPDVAARVATWVGEAVSLIRSRTVDPAAFVARVLVY
FT                   GLLAAAVGVVVLILSIDAVVKLLDAYAFGNRVWITEFVVAALSLAGSAVAWRRMGRARR
FT                   RLGA"
FT                   /protein_id="YP_003108677.1"
FT   gene            31574..32536
FT                   /db_xref="GeneID:8322076"
FT                   /locus_tag="Afer_0030"
FT   CDS_pept        31574..32536
FT                   /locus_tag="Afer_0030"
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /codon_start="1"
FT                   /EC_number="1.8.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: fra:Francci3_4536 thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="GI:256370854"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR000759"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8322076"
FT                   /translation="MPEHVKVVIIGSGPAGLTAAIYAARASLEPVVIEGEPSSTSDQPG
FT                   GQLMLTTEIENFPGFPEGILGPELMANMRQQAERFGARFRGTKVSRLDLAERPFAVHTN
FT                   DDRSGEPAYLADAVIMATGARSLMLGLEREYELIGHGVSTCATCDGFFFRGHDIAVVGG
FT                   GDSALEEALFLTKFASSVTIIHRRDQLRASRIMQQRAFANEKIRFAWNRRVVELLERDG
FT                   VLVGVRTEDTVTGEREDLGVTGLFIAIGHAPSTEIVKGQLEMDDAGYLITKPGSTETSV
FT                   DGVFAAGDVQDHTYRQAITAAGSGCQAALDVERFLAARE"
FT                   /product="thioredoxin reductase"
FT                   /protein_id="YP_003108678.1"
FT   misc_feature    31589..32521
FT                   /note="thioredoxin-disulfide reductase; Region: TRX_reduct;
FT                   TIGR01292"
FT                   /db_xref="CDD:162288"
FT                   /locus_tag="Afer_0030"
FT   misc_feature    31589..>31747
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Afer_0030"
FT   misc_feature    32045..32269
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Afer_0030"
FT   gene            32599..32931
FT                   /db_xref="GeneID:8322077"
FT                   /locus_tag="Afer_0031"
FT   CDS_pept        32599..32931
FT                   /locus_tag="Afer_0031"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /codon_start="1"
FT                   /product="thioredoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: mmi:MMAR_5478 thioredoxin TrxC"
FT                   /db_xref="GI:256370855"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR006662"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="GeneID:8322077"
FT                   /translation="MAGHEVILTDKNFDETVKASELPVLVDFWAEWCGPCKMIDPILEE
FT                   LADEMSDKLVIGKLNVDESLEIARRFEIMSIPTLMLFKEGEPVKRVIGAMPKRALLKEL
FT                   QPALED"
FT                   /protein_id="YP_003108679.1"
FT   misc_feature    32629..32913
FT                   /note="TRX family; composed of two groups: Group I, which
FT                   includes proteins that exclusively encode a TRX domain; and
FT                   Group II, which are composed of fusion proteins of TRX and
FT                   additional domains. Group I TRX is a small ancient protein
FT                   that alter the redox...; Region: TRX_family; cd02947"
FT                   /db_xref="CDD:48496"
FT                   /locus_tag="Afer_0031"
FT   misc_feature    order(32695..32697,32704..32706)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48496"
FT                   /locus_tag="Afer_0031"
FT   gene            32949..33920
FT                   /db_xref="GeneID:8322078"
FT                   /locus_tag="Afer_0032"
FT   CDS_pept        32949..33920
FT                   /locus_tag="Afer_0032"
FT                   /gene_family="HOG000022674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /codon_start="1"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   ace:Acel_2150 cell wall hydrolase/autolysin"
FT                   /db_xref="GI:256370856"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:8322078"
FT                   /translation="MPFVSLRGGERSERVEDLCRRLRRLGFELEVRDEFDDEVAEAIVA
FT                   FQRRRGLPETGVVDLVTWRAVVEAGFRIGDRLLYLKRPALRGDDVAWLQGKLGSLGFDP
FT                   GRVDGIFGPRTRSALMEFQANMGLPADGMCGAATIEELRRVDLHHGAHVHGVIERLSRA
FT                   DRHSRFSDVAVVVAAEAALEGVADLVAARVRRRGGRSVVLVSDVQSELARTINDVAPDV
FT                   FVHLGYSLGGRYVAYYSGYNYVSPVGRQLAEVVSQTAGAVRGLVERGMSIPILRETRAP
FT                   GVSIAFSNPHEWWMLAPDLSDIIVTSVEAVVCRARPTGNHRD"
FT                   /protein_id="YP_003108680.1"
FT   misc_feature    32979..33143
FT                   /note="Putative peptidoglycan binding domain; Region:
FT                   PG_binding_1; pfam01471"
FT                   /db_xref="CDD:144895"
FT                   /locus_tag="Afer_0032"
FT   misc_feature    33204..33374
FT                   /note="Putative peptidoglycan binding domain; Region:
FT                   PG_binding_1; pfam01471"
FT                   /db_xref="CDD:144895"
FT                   /locus_tag="Afer_0032"
FT   gene            34016..34092
FT                   /note="tRNA-Ile1"
FT                   /db_xref="GeneID:8322079"
FT                   /locus_tag="Afer_R0001"
FT   tRNA            34016..34092
FT                   /db_xref="GeneID:8322079"
FT                   /locus_tag="Afer_R0001"
FT                   /product="tRNA-Ile"
FT   gene            34708..35217
FT                   /db_xref="GeneID:8322080"
FT                   /locus_tag="Afer_0033"
FT   CDS_pept        34708..35217
FT                   /locus_tag="Afer_0033"
FT                   /gene_family="HOG000029676" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: cmi:CMM_2452 Cro/CI family
FT                   transcriptional regulator/nucleotidyltransferase"
FT                   /db_xref="GI:256370857"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="GeneID:8322080"
FT                   /translation="MDSVGEVLREARRRAGLTQAELGRRAGVTQSVVSAYESGARQPSV
FT                   SMLARLVAAAGAELRMELSEPAGAAAPGGELGQRLRDRRAELQRILARYGLRNARLFGS
FT                   VARGDAGPDSDIDLLVDVPGGVGLVTLGRCQAEVEQLLGVHVDLVPASDLKAGVAAEVL
FT                   SEAVPL"
FT                   /protein_id="YP_003108681.1"
FT   misc_feature    34720..34884
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(34732..34734,34744..34746,34819..34821)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(34741..34743,34816..34818)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(34762..34767,34798..34800,34807..34809,34819..34824)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    34948..35172
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(35011..35019,35026..35028,35047..35052,35056..35058,
FT                   35140..35142,35146..35148)
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(35011..35019,35026..35028,35047..35052,35056..35058)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(35050..35052,35056..35058,35146..35148)
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Afer_0033"
FT   misc_feature    order(35140..35142,35146..35148)
FT                   /note="antibiotic binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Afer_0033"
FT   gene            35214..35567
FT                   /db_xref="GeneID:8322081"
FT                   /locus_tag="Afer_0034"
FT   CDS_pept        35214..35567
FT                   /locus_tag="Afer_0034"
FT                   /gene_family="HOG000219663" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF86"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   tel:tll2231 hypothetical protein"
FT                   /db_xref="GI:256370858"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="GeneID:8322081"
FT                   /translation="MSPRERQRLQDILVAIAVIRSHLERGDLNDGLVVDAVRVRLIEIG
FT                   QAVKALPQELLAQEPALPWAQIAGMRDRLAHRYFDASHAILAATVNEDLPILEAAVGRL
FT                   ERIVADAAVWPRP"
FT                   /protein_id="YP_003108682.1"
FT   misc_feature    35214..35525
FT                   /note="Protein of unknown function DUF86; Region: DUF86;
FT                   cl01031"
FT                   /db_xref="CDD:154157"
FT                   /locus_tag="Afer_0034"
FT   gene            complement(35856..36818)
FT                   /db_xref="GeneID:8322082"
FT                   /locus_tag="Afer_0035"
FT   CDS_pept        complement(35856..36818)
FT                   /locus_tag="Afer_0035"
FT                   /gene_family="HOG000026004" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01250"
FT                   /codon_start="1"
FT                   /EC_number="3.4.11.5"
FT                   /transl_table="11"
FT                   /note="KEGG: fjo:Fjoh_1984 proline-specific peptidase;
FT                   TIGRFAM: proline-specific peptidase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="GI:256370859"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="GeneID:8322082"
FT                   /translation="MDLHDYLDARTRDDALSGGARRIPIHTPRGTFSVWTKRVGNAPDL
FT                   RVLLLHGGPGATSEYFECFDSYLPLAAIEYIYYDQLGCGRSDRPDDPSLWTLDRYVDEV
FT                   EQVRRALGLDASNFVLLGHSWGGILAMEYAIRHGDTLRGLVISNMMASAPAYNRYADEV
FT                   LIPALDPAIVAEARALEAAGDTESGRYEELLMGSYYLEHTLRMPLDEWPEPVVRAFAHT
FT                   NRDIYVPMQGPSEMGMAGDASLKDWDRFDDLVSIEVPTLVIGATHDTMDPDHMRQMAER
FT                   LPQGQFLLCPNGSHMCMYDDQATYMAGLIEFLTALRERA"
FT                   /product="proline-specific peptidase"
FT                   /protein_id="YP_003108683.1"
FT   misc_feature    complement(35880..36746)
FT                   /note="proline-specific peptidases, Bacillus coagulans-type
FT                   subfamily; Region: pro_imino_pep_2; TIGR01250"
FT                   /db_xref="CDD:162270"
FT                   /locus_tag="Afer_0035"
FT   misc_feature    complement(35931..36599)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Afer_0035"
FT   gene            36917..38089
FT                   /db_xref="GeneID:8322083"
FT                   /locus_tag="Afer_0036"
FT   CDS_pept        36917..38089
FT                   /locus_tag="Afer_0036"
FT                   /gene_family="HOG000270429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cma:Cmaq_1162 major facilitator transporter"
FT                   /db_xref="GI:256370860"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8322083"
FT                   /translation="MTQAATWRNRDVWLISLSAGFADLGYQAIVAGVPLLIVVDLRASA
FT                   LVYGVAAGLGYGLGTFASLAGGRLADRIGRRPVAIGGNLGILLLSLIALARSVPIVVLL
FT                   FVLGWLARNFRSPVRRAMLTEAVAPEWRRNAFGLLHAVDVGGGVLSALAAVVLVGAHVV
FT                   GLRGLFAFTAIPIAISSLLLASAHPHRTGGAGARRDVPTAPASTLRRAVLVATALYGFS
FT                   SYALGFPVLAVAARSGSATEGFGAYALFLGASAITGYVIGARRGSPIGWLALGGYGLSA
FT                   LGSALLVPESAMVSIIGVGLLGVGLGVIETLEPTVISRLAPDAAQGGALGALSAARSVG
FT                   LFVADVVAGLLYASHGGVAFVYGAVLAAVAAIIIGAQAPLARRTFPAGQW"
FT                   /protein_id="YP_003108684.1"
FT   gene            complement(38103..39182)
FT                   /db_xref="GeneID:8322084"
FT                   /locus_tag="Afer_0037"
FT   CDS_pept        complement(38103..39182)
FT                   /locus_tag="Afer_0037"
FT                   /gene_family="HOG000224236" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /codon_start="1"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   saq:Sare_5081 myo-inositol-1-phosphate synthase"
FT                   /db_xref="GI:256370861"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="GeneID:8322084"
FT                   /translation="MGTIRLAIAGVGNCASSLVQGIEYYRNATDDQDVPGLMHVTLGGY
FT                   HVRDIEVVAAFDVDDEKVGLDVSKAVFASHNNTIKFADVPEAGVTVDRGPTLDGLGTYY
FT                   RQVVTESPLPPVDVAARLREARADVLVAYLPVGSEQAQRAYAEAALEAGVAFVNAIPVF
FT                   IASDPVWAERFREAGVPIIGDDIKSQVGATIVHRMLARLFEDRGLVLDRTYQLNVGGNM
FT                   DFMNMLERSRLESKKISKTQSVTSQIEHGIDSHNVHIGPSDHVAWLEDRKWAYIRLEGR
FT                   NFGDVPLNVELKLEVWDSPNSAGVIIDAVRCAKIALDRGIGGPLEGPSAYFMKSPPRQL
FT                   HDEDARRAVEEFARGDADR"
FT                   /protein_id="YP_003108685.1"
FT   misc_feature    complement(38121..39173)
FT                   /note="Myo-inositol-1-phosphate synthase; Region:
FT                   NAD_binding_5; pfam07994"
FT                   /db_xref="CDD:149206"
FT                   /locus_tag="Afer_0037"
FT   misc_feature    complement(38127..39173)
FT                   /note="Myo-inositol-1-phosphate synthase; Region:
FT                   Inos-1-P_synth; cl00554"
FT                   /db_xref="CDD:174282"
FT                   /locus_tag="Afer_0037"
FT   gene            complement(39269..39862)
FT                   /db_xref="GeneID:8322085"
FT                   /locus_tag="Afer_0038"
FT   CDS_pept        complement(39269..39862)
FT                   /locus_tag="Afer_0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: fra:Francci3_4528 PadR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:256370862"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="GeneID:8322085"
FT                   /translation="MVSSERAKELTAVELATLVVLEAAPAHGYEVARRLQATFGEIGRF
FT                   SYGSIYPALARLARSGLIASVGAVGRLDPARLPGVLAAELVLAASTAGGRSRRTYRITD
FT                   EGRARLRTALEFADMADDRIATIALVASSLVAPETRRALLRGRRRSLVERLEELDRLEQ
FT                   EMPDLWLDIVRARTASELAVLDAAPAGYGASTTS"
FT                   /protein_id="YP_003108686.1"
FT   misc_feature    complement(39530..39790)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Afer_0038"
FT   gene            39960..40349
FT                   /db_xref="GeneID:8322086"
FT                   /locus_tag="Afer_0039"
FT   CDS_pept        39960..40349
FT                   /locus_tag="Afer_0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ace:Acel_2136 hypothetical protein"
FT                   /db_xref="GI:256370863"
FT                   /db_xref="GeneID:8322086"
FT                   /translation="MDQGRAREVGGRLATSVDHRLLRWRTLRALAAGTIVREDVCDAGF
FT                   ELSRAASAFGIPRGVVCPVCAADALREVAFAFGKGLPHEGQVVGGTLVEEALDAVPDVR
FT                   LFRVEVCLACRWNFVIEERGHTGVR"
FT                   /protein_id="YP_003108687.1"
FT   gene            40429..41328
FT                   /db_xref="GeneID:8322087"
FT                   /locus_tag="Afer_0040"
FT   CDS_pept        40429..41328
FT                   /locus_tag="Afer_0040"
FT                   /gene_family="HOG000078427" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /codon_start="1"
FT                   /EC_number="2.1.2.11"
FT                   /transl_table="11"
FT                   /note="KEGG: bja:blr2101 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="GI:256370864"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="GeneID:8322087"
FT                   /translation="MESASMSDRIATVPAIAGSKVRSGSRPLVMVTAYDAPGARIADDG
FT                   GVDMILVGDSVAMAVLGMPDTLGVRVRDIAHHVAAVRRAQPRALVVADLPWLSYHRGRR
FT                   RAVEAAGKLVRAGAQAVKLEGGRERLDVIDALVRAQIPVMGHLGLTPQSANVFGGMVVQ
FT                   GRSIVAAERILADAMALEQAGVFAMVLEGIPAPIASVVTARVGVPTIGIGAGAGCDGQV
FT                   LVFHDLLGFADGHRPRFVKTYAELGAAAREAVAAWAKDVTEGAYPDDAHAYRASTELAA
FT                   WAERQLTSEERRGGAPRS"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /protein_id="YP_003108688.1"
FT   misc_feature    40504..41229
FT                   /note="Ketopantoate hydroxymethyltransferase (KPHMT) is the
FT                   first enzyme in the pantothenate biosynthesis pathway.
FT                   Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes the
FT                   first committed step in the biosynthesis of pantothenate
FT                   (vitamin B5), which is a...; Region: KPHMT-like; cd06557"
FT                   /db_xref="CDD:119342"
FT                   /locus_tag="Afer_0040"
FT   misc_feature    order(40522..40524,40579..40581,40585..40593,40705..40707,
FT                   40792..40794,40864..40866,40879..40881,40999..41001,
FT                   41092..41094,41098..41100)
FT                   /note="active site"
FT                   /db_xref="CDD:119342"
FT                   /locus_tag="Afer_0040"
FT   misc_feature    order(40531..40542,40549..40551,40594..40596,40600..40617,
FT                   40627..40632,40645..40647,40654..40659,40666..40668,
FT                   40675..40677,40714..40719,40747..40749,40759..40761,
FT                   40768..40773,40783..40785,40837..40854,40882..40887,
FT                   40891..40902,40984..40986,41104..41106,41113..41118,
FT                   41158..41160,41167..41181)
FT                   /note="oligomerization interface; other site"
FT                   /db_xref="CDD:119342"
FT                   /locus_tag="Afer_0040"
FT   misc_feature    order(40588..40590,40705..40707,40792..40794)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:119342"
FT                   /locus_tag="Afer_0040"
FT   gene            complement(41325..43082)
FT                   /db_xref="GeneID:8322088"
FT                   /locus_tag="Afer_0041"
FT   CDS_pept        complement(41325..43082)
FT                   /locus_tag="Afer_0041"
FT                   /gene_family="HOG000113195" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /codon_start="1"
FT                   /product="replicative DNA helicase"
FT                   /transl_table="11"
FT                   /note="KEGG: cya:CYA_1550 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase;
FT                   Hedgehog/intein hint domain protein"
FT                   /db_xref="GI:256370865"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="GeneID:8322088"
FT                   /translation="MARSQGPEDRLPPHNIEAEESLLGAMLLSREAIGDAVELVEADDF
FT                   FRPSHRELFRVLADLYARGETTDPVSVGDELRRLGIEEALGGQEGLNRLVIQTPAIASA
FT                   GRYAQIVRDYGILRRLIRTASDIAEEAYGLPKDVRALLDHAEASILNVARGTSHESAAH
FT                   LEQVLMEVLEQLEQVAGSDDLGAFAVPTGFRDLDELLTGLHRSNLIIVGARPGMGKTSF
FT                   ALSMALNVARNQSEPVLLFSLEMNRIELGQRLVASQARVNSQRLRSGRLNEREWDQVSN
FT                   AAGELATRPILIDDDPNLTVLDLRTRARRIKAEQGLSLVVIDYLQLMSSRRQSESRQLE
FT                   VSEISRGLKLLARELDVPIIALSQLSRNLESRSDRRPQLADLRESGCLSWDAKVRLADG
FT                   TEVPIGMLWSKGARSVPLASVTPEGVPTVAMGTRVVATGLKPLRRLTLANGSILRATGN
FT                   HPIATSSGWREAGTLVSGDVVHVLLDATTVATTVVESVDELGTELVFDIEVPETHAFVA
FT                   DGVIVHNSLEQDADVVMFIYRDELYHPDTTDRGVAEIIVAKHRNGPQGTVNLAFIADWT
FT                   RFADIAPSD"
FT                   /protein_id="YP_003108689.1"
FT   misc_feature    complement(42744..43049)
FT                   /note="DnaB-like helicase N terminal domain; Region: DnaB;
FT                   pfam00772"
FT                   /db_xref="CDD:144390"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(41901..43040)
FT                   /note="HK022 subfamily; Region: phage_DnaB; TIGR03600"
FT                   /db_xref="CDD:132639"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(41901..42503)
FT                   /note="DnaB helicase C terminal domain. The hexameric
FT                   helicase DnaB unwinds the DNA duplex at the  chromosome
FT                   replication fork. Although the mechanism by which DnaB both
FT                   couples ATP hydrolysis to translocation along DNA and
FT                   denatures the duplex is unknown, a...; Region: DnaB_C;
FT                   cd00984"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(42423..42443)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(order(41991..41993,42114..42116,42423..42428))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(42114..42125)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(order(41970..41996,42069..42077,42096..42101))
FT                   /note="DNA binding loops"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(41511..41924)
FT                   /note="Hedgehog/Intein domain, found in Hedgehog proteins
FT                   as well as proteins which contain inteins and undergo
FT                   protein splicing (e.g. DnaB, RIR1-2, GyrA and Pol). In
FT                   protein splicing an intervening polypeptide sequence - the
FT                   intein - is excised from a...; Region: Hint; cd00081"
FT                   /db_xref="CDD:73181"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(order(41511..41516,41706..41708,41922..41924))
FT                   /note="protein-splicing catalytic site; other site"
FT                   /db_xref="CDD:73181"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(order(41706..41708,41715..41717,41922..41924))
FT                   /note="thioester formation/cholesterol transfer; other
FT                   site"
FT                   /db_xref="CDD:73181"
FT                   /locus_tag="Afer_0041"
FT   misc_feature    complement(41370..>41510)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Afer_0041"
FT   gene            complement(43096..43548)
FT                   /db_xref="GeneID:8322089"
FT                   /locus_tag="Afer_0042"
FT   CDS_pept        complement(43096..43548)
FT                   /locus_tag="Afer_0042"
FT                   /gene_family="HOG000040337" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: fre:Franean1_7309 ribosomal protein L9"
FT                   /db_xref="GI:256370866"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="GeneID:8322089"
FT                   /translation="MNVLLRARVQGLGDRGDIVRVADGYARNYLIPRRLAVAATPKIAH
FT                   QAEAMRAKAQLARERERAEAEATARQLAGIELALSARASEEGTLFGSITAADIVRAIAE
FT                   ATGVTIEREHVRIPAPIKQVGEHPVVIALGHGVDVAITVSVAASER"
FT                   /protein_id="YP_003108690.1"
FT   misc_feature    complement(43105..43548)
FT                   /note="50S ribosomal protein L9; Reviewed; Region: rplI;
FT                   PRK00137"
FT                   /db_xref="CDD:166815"
FT                   /locus_tag="Afer_0042"
FT   misc_feature    complement(43423..43548)
FT                   /note="Ribosomal protein L9, N-terminal domain; Region:
FT                   Ribosomal_L9_N; pfam01281"
FT                   /db_xref="CDD:144760"
FT                   /locus_tag="Afer_0042"
FT   misc_feature    complement(43105..43329)
FT                   /note="Ribosomal protein L9, C-terminal domain; Region:
FT                   Ribosomal_L9_C; pfam03948"
FT                   /db_xref="CDD:146531"
FT                   /locus_tag="Afer_0042"
FT   gene            complement(43545..43952)
FT                   /db_xref="GeneID:8322090"
FT                   /locus_tag="Afer_0043"
FT   CDS_pept        complement(43545..43952)
FT                   /locus_tag="Afer_0043"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S18"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: tfu:Tfu_3093 30S ribosomal protein S18"
FT                   /db_xref="GI:256370867"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="GeneID:8322090"
FT                   /translation="MPKTATKRKRRGREAPETKRIKKKPCVFCQQHVDWVDYKDVDLLR
FT                   RFTSERAKIRARRVTGNCAQHQADVANAIKVARELALLPYVIRPVSDRSRRNQGDQPVG
FT                   DRELRSRNRAQATDRTSADEEETPAAEEEQA"
FT                   /protein_id="YP_003108691.1"
FT   misc_feature    complement(43695..43889)
FT                   /note="Ribosomal protein S18; Region: Ribosomal_S18;
FT                   cl00373"
FT                   /db_xref="CDD:174155"
FT                   /locus_tag="Afer_0043"
FT   gene            complement(43956..44402)
FT                   /db_xref="GeneID:8322091"
FT                   /locus_tag="Afer_0044"
FT   CDS_pept        complement(43956..44402)
FT                   /locus_tag="Afer_0044"
FT                   /gene_family="HOG000106485" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: fal:FRAAL6852 single-strand DNA-binding
FT                   protein"
FT                   /db_xref="GI:256370868"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:8322091"
FT                   /translation="MSAGNSVTLVGNLTKEPELRFTAQGRAQALFSIAVNRRRLNQQTQ
FT                   EWEESTSFFEVICWGDLADNVSTSLEKGSRAIIVGRLEQRSWETPEGERRSKVQVVAEE
FT                   VGPSLRWATAEVHRTERRTGSGRPVTNEPSPVADGGVGYEEEPF"
FT                   /protein_id="YP_003108692.1"
FT   misc_feature    complement(44082..44384)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Afer_0044"
FT   misc_feature    complement(order(44109..44111,44118..44120,44151..44153,
FT                   44178..44180,44241..44243,44247..44249,44292..44300,
FT                   44373..44384))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Afer_0044"
FT   misc_feature    complement(order(44100..44102,44106..44108,44145..44150,
FT                   44154..44156,44160..44162,44184..44189,44226..44228,
FT                   44232..44234,44238..44240,44244..44246,44250..44255,
FT                   44289..44294,44313..44315,44343..44345,44361..44369))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Afer_0044"
FT   misc_feature    complement(order(44085..44087,44166..44168,44172..44174,
FT                   44178..44180))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Afer_0044"
FT   gene            complement(44430..44768)
FT                   /db_xref="GeneID:8322092"
FT                   /locus_tag="Afer_0045"
FT   CDS_pept        complement(44430..44768)
FT                   /locus_tag="Afer_0045"
FT                   /gene_family="HOG000040440" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S6"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: tte:TTE2781 30S ribosomal protein S6"
FT                   /db_xref="GI:256370869"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="GeneID:8322092"
FT                   /translation="MREYELALITSPALDEEARTALFDRIRSIVNQGGGAITQEAHWGR
FT                   RMLAYPIAHRTDGAYSFLRLHAEPATIDELDRVLSIADGVLRHKTIRLPDALAANGKIP
FT                   LLGAPGRA"
FT                   /protein_id="YP_003108693.1"
FT   misc_feature    complement(44460..44768)
FT                   /note="Ribosomal protein S6; Region: Ribosomal_S6; cl00414"
FT                   /db_xref="CDD:174188"
FT                   /locus_tag="Afer_0045"
FT   gene            complement(44852..45481)
FT                   /db_xref="GeneID:8322093"
FT                   /locus_tag="Afer_0046"
FT   CDS_pept        complement(44852..45481)
FT                   /locus_tag="Afer_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370870"
FT                   /db_xref="GeneID:8322093"
FT                   /translation="MLRTKTLDRLLAADLALFGALLLVAIWYPSSAIDGYGISYYLTHL
FT                   DSFIPLAIGFVLCAVLSWRAGRDLPTTGGLGVLRRALRMMAVLIVGIAFTPYTWGTLFD
FT                   WTHQTLGSILFVEQLLMSGWIWWRYARSWFNATMIVMQIVGGVMALLSLPNDGIMVLFQ
FT                   GEVIFQIGFSFLLFHSLSRLIPDELEAQLPLHRHDEPPIGQARAHS"
FT                   /protein_id="YP_003108694.1"
FT   gene            45648..46052
FT                   /db_xref="GeneID:8322094"
FT                   /locus_tag="Afer_0047"
FT   CDS_pept        45648..46052
FT                   /locus_tag="Afer_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370871"
FT                   /db_xref="GeneID:8322094"
FT                   /translation="MVGQRWAALGTSGRIVTVVSVIVLIALFLPWYGVSIGSLSVSVDG
FT                   LHSYGLLTALGVVVVAVGVGANAPWVRGARLAGVVLEAVGAVAFLAAYHAAGSTSALSV
FT                   SFGPEIGVYLALLASLVGVVAALNERRRAV"
FT                   /protein_id="YP_003108695.1"
FT   gene            46052..46750
FT                   /db_xref="GeneID:8322095"
FT                   /locus_tag="Afer_0048"
FT   CDS_pept        46052..46750
FT                   /locus_tag="Afer_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370872"
FT                   /db_xref="GeneID:8322095"
FT                   /translation="MRRLAWMMVAGATLAACGTATAQVTGPVARAARALASVPLHFCFV
FT                   IDATAQDAQERISGCGDESAGARRLALTQNLLEQVGSQRQQSSEGVIEIGSKEWVSSSK
FT                   VWQLVTPTTNVIEPLAVADLVDAAPGFVVGRGSVVDGVQALAYSTVLEGSSLSRTLARL
FT                   PAALAEQYRGENLRSDDLTVELSPQGRLLEVDQHQSLVVSGQAVTAVSVLVLSRFGQSV
FT                   TVTPPSPVAG"
FT                   /protein_id="YP_003108696.1"
FT   gene            complement(46722..47768)
FT                   /db_xref="GeneID:8322096"
FT                   /locus_tag="Afer_0049"
FT   CDS_pept        complement(46722..47768)
FT                   /locus_tag="Afer_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /codon_start="1"
FT                   /product="sodium/hydrogen exchanger"
FT                   /transl_table="11"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   ank:AnaeK_3726 sodium/hydrogen exchanger"
FT                   /db_xref="GI:256370873"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="GeneID:8322096"
FT                   /translation="MTALSLGVLLAASIVGSLRHSSSRIPTALVMLVVGTLVALLPHPA
FT                   VATHIATTAESLGVYVVLFGIGEELQGSGSHPIAGRGLAIAGIGASLLGLGAFGAVLVS
FT                   GVGAVRALAIALAAIPTSGALAATVLPLAHVPRGSRTSILQAAIGDDLVSLALLAAAPF
FT                   VLPTGARPTSVVATVVAVVIALVLRQTGARAPRLLGALVVTATCAFGTSPALAGALAGA
FT                   LLHDLVPRAAVVTWSRRTLGLMFFATAGFVLGSLGPLWRMNVAVVVGLLVALAISRLGL
FT                   YLLIARPDRWIAVGMLPRGEVTIAIATALRSVIGAAGGEALLAVVLLSTVAAVLAGHRL
FT                   SRRPETGA"
FT                   /protein_id="YP_003108697.1"
FT   gene            47864..48529
FT                   /db_xref="GeneID:8322097"
FT                   /locus_tag="Afer_0050"
FT   CDS_pept        47864..48529
FT                   /locus_tag="Afer_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03640"
FT                   /codon_start="1"
FT                   /product="secreted repeat of unknown function"
FT                   /transl_table="11"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   ace:Acel_0027 hypothetical protein"
FT                   /db_xref="GI:256370874"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="GeneID:8322097"
FT                   /translation="MVAAPLVLASCHFSNGDYGPAGAGGGTTSSASSGPIGANTTAPDA
FT                   KLLGGSAAPKTASTYDGAGFPIPTYPPVPCPRATCLNGSPLEPVEISWRNSPYGPILTT
FT                   ASGETLYLRLGDGFRESGCHGICLRAFPPLLTNGAPQAAPGLLAADVGDLTASNGKEQA
FT                   SYGGHPLYTYRGDTKPGQYGAEGKGGIWYVVSITGLPVKAPVHSGTSSSSATTSTSNG"
FT                   /protein_id="YP_003108698.1"
FT   misc_feature    <48158..48442
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG4315"
FT                   /db_xref="CDD:34037"
FT                   /locus_tag="Afer_0050"
FT   misc_feature    48335..48445
FT                   /note="Secreted repeat of unknown function; Region:
FT                   Lipoprotein_15; pfam03640"
FT                   /db_xref="CDD:112457"
FT                   /locus_tag="Afer_0050"
FT   gene            complement(48548..50578)
FT                   /db_xref="GeneID:8322098"
FT                   /locus_tag="Afer_0051"
FT   CDS_pept        complement(48548..50578)
FT                   /locus_tag="Afer_0051"
FT                   /gene_family="HOG000217684" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: fre:Franean1_0238
FT                   hypothetical protein"
FT                   /db_xref="GI:256370875"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8322098"
FT                   /translation="MRLAIGLAIIVVALALTIRRAVVLIRAVRRGPASPGRRASLARRA
FT                   RAEVVEVLGQRRLLTKRVPGLAHFFTFWGFTILLVTVVEAVGALFDRHFAFPIIGHEPW
FT                   LGALEDTMAFLVLVSLVVFAVIRLREAPQRRERASRFYGSHTGVAWLTLGWIAAVIVTL
FT                   VAYRATQVNDGDFPYRSGAWLSEIVALPFRHMGAHTNYELESIFLVANVAVIFAFLVFI
FT                   VHSKHLHIATAPINVAFARRPRALGALATTPDLDPEAFDEATVLGVGTIGQLDWKHRLD
FT                   TLACTECGRCQELCPAWGTGKPLSPKLLIMSLREAVLAHGANPEAQETSLVPDVVDPEV
FT                   LWACTTCGACVAACPVDIEHVDTIVDLRRYQVLMESSFPTEAGGMLRNLENRGDPWGLG
FT                   ASHRLDWLKGLDVEVPVFDGQIPADVEVLLWVGCAGALDERAQAVTRATATLLAKAGVR
FT                   FGVLGPRETCTGDPARRMGNEYLYQMQARQVIDTLTEAGARSIVTSCPHCFNTIRNEYP
FT                   ALGGNWEVRHHSELLAELVRDGRLPVEAGSIASATFHDSCYLGRHNGVYDAPRAVVGAA
FT                   LGADPLEMERNRSRSFCCGAGGARMWMEEAKGQRVNDARVTQALATGVDVVGVACPFCM
FT                   IMLDDGLKARQATGDAPEHVRVADISQVLLGALRTPSTPVD"
FT                   /protein_id="YP_003108699.1"
FT   misc_feature    complement(48572..49756)
FT                   /note="Fe-S oxidoreductase [Energy production and
FT                   conversion]; Region: GlpC; COG0247"
FT                   /db_xref="CDD:30596"
FT                   /locus_tag="Afer_0051"
FT   misc_feature    complement(49040..49225)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="Afer_0051"
FT   misc_feature    complement(48662..48856)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="Afer_0051"
FT   gene            complement(50613..51218)
FT                   /db_xref="GeneID:8322099"
FT                   /locus_tag="Afer_0052"
FT   CDS_pept        complement(50613..51218)
FT                   /locus_tag="Afer_0052"
FT                   /gene_family="HOG000228601" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /codon_start="1"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mva:Mvan_0589 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="GI:256370876"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="GeneID:8322099"
FT                   /translation="MILSDRSLRDALAAGRISVDPLSPGAIQPSSIDLRLDALFRVFRN
FT                   YSAGHLDLAAIPDDLTELVEVPFGRAFMLHPGEFVLGSTIEHVRVGEDLVARLEGKSSL
FT                   GRLGLLIHSTAGFIDPGFEGHVTLELSNVAQLPITLYPGMRVGQISFLQMTSPAEHPYG
FT                   SAALASKYQGQRGPTPSRYHLDHDDIKGDRRHHEATEW"
FT                   /protein_id="YP_003108700.1"
FT   misc_feature    complement(50697..>51218)
FT                   /note="2'-deoxycytidine 5'-triphosphate deaminase (DCD);
FT                   Region: DCD; pfam06559"
FT                   /db_xref="CDD:148267"
FT                   /locus_tag="Afer_0052"
FT   misc_feature    complement(50766..51005)
FT                   /note="Trimeric dUTP diphosphatases; Region:
FT                   trimeric_dUTPase; cd07557"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Afer_0052"
FT   misc_feature    complement(order(50775..50777,50787..50789,50796..50810,
FT                   50820..50822,50826..50828,50832..50834,50838..50840,
FT                   50859..50861,50868..50870,50886..50894,50907..50924,
FT                   50928..50930,50976..50978,50982..50987,51000..51002))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Afer_0052"
FT   misc_feature    complement(order(50838..50843,50853..50855,50862..50870,
FT                   50910..50918))
FT                   /note="active site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Afer_0052"
FT   gene            51268..51341
FT                   /note="tRNA-Gly1"
FT                   /db_xref="GeneID:8322100"
FT                   /locus_tag="Afer_R0002"
FT   tRNA            51268..51341
FT                   /db_xref="GeneID:8322100"
FT                   /locus_tag="Afer_R0002"
FT                   /product="tRNA-Gly"
FT   gene            complement(51587..52653)
FT                   /db_xref="GeneID:8322101"
FT                   /locus_tag="Afer_0053"
FT                   /pseudo
FT   gene            52830..53132
FT                   /db_xref="GeneID:8322102"
FT                   /locus_tag="Afer_0054"
FT                   /pseudo
FT   gene            complement(53466..54029)
FT                   /db_xref="GeneID:8322103"
FT                   /locus_tag="Afer_0055"
FT   CDS_pept        complement(53466..54029)
FT                   /locus_tag="Afer_0055"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BCG_3106"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mbb:BCG_3106 hypothetical protein"
FT                   /db_xref="GI:256370877"
FT                   /db_xref="GeneID:8322103"
FT                   /translation="MSEPRPRFNATLILEAFNRLADELERRGVVAEIYVVGGNALALAY
FT                   EARRITRDVDAVFEPKATVREAASTVAIEMGLPEDWLNDGARAFFPGPDPASTVVIRRP
FT                   GLTVSVASPRQLLAMKLLASRADQDVDDIKLLYGLCGMRTAADGLALLEAVYPNRPVPA
FT                   RTRFLLEELFGHLLPHSLEQPRPS"
FT                   /protein_id="YP_003108701.1"
FT   gene            complement(54022..54441)
FT                   /db_xref="GeneID:8322104"
FT                   /locus_tag="Afer_0056"
FT   CDS_pept        complement(54022..54441)
FT                   /locus_tag="Afer_0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Franean1_6980"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fre:Franean1_6980 hypothetical protein"
FT                   /db_xref="GI:256370878"
FT                   /db_xref="GeneID:8322104"
FT                   /translation="MDLVLRPQVRRGAKPVADVATTITELLHTEGVRSAWREVLDFVDD
FT                   VRGSSRLGKAWLVADPPPLCGDTRFDAALAGIVEFLCNEAGIAAPSWTTEATRYVEPWW
FT                   FVAGLPGYEAMALRDSPVELKRHGVFVNEGAFDRV"
FT                   /protein_id="YP_003108702.1"
FT   gene            complement(54460..54594)
FT                   /db_xref="GeneID:8322105"
FT                   /locus_tag="Afer_0057"
FT                   /pseudo
FT   gene            54684..54907
FT                   /db_xref="GeneID:8322106"
FT                   /locus_tag="Afer_0058"
FT                   /pseudo
FT   gene            complement(55114..55506)
FT                   /db_xref="GeneID:8322107"
FT                   /locus_tag="Afer_0059"
FT   CDS_pept        complement(55114..55506)
FT                   /locus_tag="Afer_0059"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370879"
FT                   /db_xref="GeneID:8322107"
FT                   /translation="MTDALCDGHLAPFMHTRGLYCDLHVSSEASLGCEVGAPYEAPLAR
FT                   SFDPLYITVPLGFSVPAMSMQCPDGLVCVDHPGTIDLSRLEPLYPQLTAAELTADLKTM
FT                   PTSGPENFVATLNEGVPSDRTSKSSV"
FT                   /protein_id="YP_003108703.1"
FT   gene            complement(55510..55656)
FT                   /db_xref="GeneID:8322108"
FT                   /locus_tag="Afer_0060"
FT   CDS_pept        complement(55510..55656)
FT                   /locus_tag="Afer_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370880"
FT                   /db_xref="GeneID:8322108"
FT                   /translation="MGRVARRRMRNGAVAFAAALATGAGIATAAASTPPPSNAVRAGQG
FT                   VNE"
FT                   /protein_id="YP_003108704.1"
FT   gene            55830..56504
FT                   /db_xref="GeneID:8322109"
FT                   /locus_tag="Afer_0061"
FT   CDS_pept        55830..56504
FT                   /locus_tag="Afer_0061"
FT                   /gene_family="HOG000266637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gvi:gll0671
FT                   TetR family transcriptional regulatory protein"
FT                   /db_xref="GI:256370881"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8322109"
FT                   /translation="MICGEHGIERVDPSATTARPRPGRPRDRRVDASVMGATLALLDEV
FT                   GYSALSLEMVARRARVGKPSIYRRWPGKASLVVDTIVTIAGTDPAPDTGSLRDDLRAVA
FT                   LAMAALYRTPLARTVVLPLLGDLADDPDLGERFRRRYVAPRRGSVHRALERAQERGEIP
FT                   RVDDPELICDLIAGPLFHRAFLVAGEIDDRFALATVDAVLIVLESGQAGDRNSGTGKGA
FT                   SQ"
FT                   /protein_id="YP_003108705.1"
FT   misc_feature    55938..56462
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Afer_0061"
FT   misc_feature    55938..56060
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Afer_0061"
FT   gene            56501..57106
FT                   /db_xref="GeneID:8322110"
FT                   /locus_tag="Afer_0062"
FT   CDS_pept        56501..57106
FT                   /locus_tag="Afer_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370882"
FT                   /db_xref="GeneID:8322110"
FT                   /translation="MSADAQRALEATRAPGTRPPLWLRTSVPVGVVSQCAAAALGTGLI
FT                   AVAADSYRLGVDLRGAALIVGFILIYLNTHAVAHWFVGRIVGIRFRGFGLRGTDHPENY
FT                   PPGLRHLMGVLPMWVAMTEPESRRRAGPRARAAMYAAGETSTTVCSVAAAAAAFLAHAP
FT                   WARGLLVFAVLWNLGASIVVSMIDKGDYAKARRALRAR"
FT                   /protein_id="YP_003108706.1"
FT   gene            complement(57262..57585)
FT                   /db_xref="GeneID:8322111"
FT                   /locus_tag="Afer_0063"
FT   CDS_pept        complement(57262..57585)
FT                   /locus_tag="Afer_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370883"
FT                   /db_xref="GeneID:8322111"
FT                   /translation="MPTVLAPSLDAVFDPSRDPLSAALEHHFGLAETHEEQWLVARPPQ
FT                   GQERGVLGLARSEWVIDIEGVAYAASRQPFDAFSLILRAHTFELHLRSSADGRLISYSP
FT                   AAT"
FT                   /protein_id="YP_003108707.1"
FT   misc_feature    complement(57322..>57585)
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="Afer_0063"
FT   gene            complement(58069..58872)
FT                   /db_xref="GeneID:8322112"
FT                   /locus_tag="Afer_0064"
FT   CDS_pept        complement(58069..58872)
FT                   /locus_tag="Afer_0064"
FT                   /gene_family="HOG000101031" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fra:Francci3_4170 hypothetical protein"
FT                   /db_xref="GI:256370884"
FT                   /db_xref="GeneID:8322112"
FT                   /translation="MPTTLDALVARSRRIEVEQIDIDAFRSHPLDDASLACLRYMCDIE
FT                   SHTVCYLCELLATPVHADPAITRFLACWVYEEQFHGDAIGKILTAHGLAGAPDAAATLR
FT                   RARRARDWLRLVGFSVFSPIAPALPGLLMAWGMVNELTTQAGYARLVARAEHPALTGVL
FT                   TEIMKQEGRHIDFYTMQARALLERPRDQRIVRSALARFWAPVGSGVKSNEEVRALISTL
FT                   FTGPGGPEVVARIDRRIERLPGLAGLHLVTSSVERLLPGFGRRAA"
FT                   /protein_id="YP_003108708.1"
FT   gene            complement(59143..60279)
FT                   /db_xref="GeneID:8322113"
FT                   /locus_tag="Afer_0065"
FT   CDS_pept        complement(59143..60279)
FT                   /locus_tag="Afer_0065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:256370885"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="GeneID:8322113"
FT                   /translation="MTGVRRRRGVAALVVLVALGIATLLVVVLHSHRRPTFSPSPPGAV
FT                   TGQLVSRGPLVVDERGTPIYLHGVDWPSLDWAPAGQHADGAPGLDLSELRSMVTRFRAN
FT                   AVRIALNEAFLLRGSPRYDPEYGELVERAVRAARRVGLVVILDLHTVIGADTSTAPAAA
FT                   GPSCAPDPPSIAFWRTLAERFRTWPGVVFELYNEPHDITWSTWRDGGLITCPATGRRYD
FT                   AIGEQTLLDTVRATGARNLVIADGIDWAGTLAGLTRWHLAGTNVAYGLHLYVQAAQPTG
FT                   PALWQHELGSTWRHWPVIATEFGVLGCSNPYPLNLERHIVDFLAGHGIGWTAWAWWDGG
FT                   CGFPSLIATEAGRPFEGGLVVEATSRALARGSLRPPLP"
FT                   /protein_id="YP_003108709.1"
FT   misc_feature    complement(59254..60111)
FT                   /note="Cellulase (glycosyl hydrolase family 5); Region:
FT                   Cellulase; cl12144"
FT                   /db_xref="CDD:159804"
FT                   /locus_tag="Afer_0065"
FT   gene            complement(60276..60413)
FT                   /db_xref="GeneID:8322114"
FT                   /locus_tag="Afer_0066"
FT   CDS_pept        complement(60276..60413)
FT                   /locus_tag="Afer_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:256370886"
FT                   /db_xref="GeneID:8322114"
FT                   /translation="MHLIVVTPQMRAVQTQLPFISAVQHEDHLVAQFGSGLSRIDIYRP
FT                   "
FT                   /protein_id="YP_003108710.1"
FT   gene            60502..60822
FT                   /db_xref="GeneID:8322115"
FT                   /locus_tag="Afer_0067"
FT   CDS_pept        60502..60822
FT                   /locus_tag="Afer_0067"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mva:Mvan_5059 transposase IS3/IS911 family protein"
FT                   /db_xref="GI:256370887"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:8322115"
FT                   /translation="MGTSRRKFTLEYRTEAAHRVIDSGRSVPEVARELAIGEHNLYRWV
FT                   REERRRIEAANATGSPPLTAQERTELIRLRRELEELRKDNEFLGKAAAYFAAKPPSKRD
FT                   SR"
FT                   /protein_id="YP_003108711.1"
FT   misc_feature    60514..>60636
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Afer_0067"
FT   gene            60822..61691
FT                   /db_xref="GeneID:8322116"
FT                   /locus_tag="Afer_0068"
FT   CDS_pept        60822..61691
FT                   /locus_tag="Afer_0068"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_5060 integrase catalytic subunit"
FT                   /db_xref="GI:256370888"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8322116"
FT                   /translation="MEAEYARFEIKRMARLLEVSRAGYYRWRRTQVAPSRRACARRDLE
FT                   NRVVAVHQASSGTYGARRITAALLAAGVVTSHNTVAAAMARRGIAGISPRRFRPATTHA
FT                   DPKAIYPPDLVARKFDPGRLHALWTSDITYLALAGAMAYLCVVRDEHSRRVLGWSVAER
FT                   METTLVLEALGQAVAVRGSHAQGVIWHTDRGSQFSDHRVVAFCARHGITRSMGRTGTCY
FT                   DHASAESFWSIFKHEFFYRHAFGDLAELRRGIQSYIQFYNHQRSCSKIGYLAPVVFEHL
FT                   VAEEARVK"
FT                   /protein_id="YP_003108712.1"
FT   misc_feature    60870..61646
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="Afer_0068"
FT   misc_feature    61200..61535
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Afer_0068"
FT   gene            complement(61634..63103)
FT                   /db_xref="GeneID:8322117"
FT                   /locus_tag="Afer_0069"
FT   CDS_pept        complement(61634..63103)
FT                   /locus_tag="Afer_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mvan_4862"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mva:Mvan_4862 glycosyl transferase family
FT                   protein"
FT                   /db_xref="GI:256370889"
FT                   /db_xref="GeneID:8322117"
FT                   /translation="MVETLVRTHEVPEAPDSTQTAARGTWSVAGNTLAWGTAAIVALVH
FT                   VAGAAHNPTPMLDEGTYAAEAWALLHLGRLAPYTYWYDHPPLAWILLAGMWWLLAHVLP
FT                   QGLDAVAQLRFAMWIWSLVALGALVGAAKRLRWHPGAAAIAVILWGLSPLAITLERLVE
FT                   LDNVAMALVLVAIWSLSDPRRRLHAVVIAGIAFGAAILSVETALLWTPTVLWLLARRYR
FT                   DERRSVAMWTFLLVTGSIGSLYLLYATLKGALLPGPGHVSLLGSAAWQVFERAGSGFIL
FT                   RHGTAAWGLLQGWLHLDPVLVLLVPAACIGVIARRTRPFGIAALVYTAMAFRPGYLPST
FT                   YPVEAFPAVALVGGGLFDSLLSQSVSWRRLARTALGVLVTTLTLLLGFAWSARDAETLL
FT                   APRDQAQLAAEAWLRAHGDRSAPILVADTMWVDVVDMGWHPYQAVVWYWKITTDPEVER
FT                   RYLRCPRFRRHPGYFTRASSATRCSKTTGAR"
FT                   /protein_id="YP_003108713.1"
FT   gene            complement(63106..64401)
FT                   /db_xref="GeneID:8322118"
FT                   /locus_tag="Afer_0070"
FT   CDS_pept        complement(63106..64401)
FT                   /locus_tag="Afer_0070"
FT                   /gene_family="HOG000224770" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mva:Mvan_4863 glycosyl transferase family protein"
FT                   /db_xref="GI:256370890"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:8322118"
FT                   /translation="MTIGDWLYLTGAVIVLTASLSAVALAAFGWEDPQLRRQLSFQISA
FT                   DSLTTLPTMAVLIPARHEETVLGATLERLARQPYDALRIIAIVGHDDQATHAVAERAAS
FT                   AHPDRIEVVVDHHWPKSKPAALITGMEAAGSAELIAIVDAEDDVAEGFFALAAAEFAMR
FT                   PGLDVLQGGVLLVNLSSSWFATRSAVEYYLWYSSRLPWQARHGVVPLGGNTCVFRSHTL
FT                   HEVGLWDPNALTEDADMGIRLATCGAQIAVRFEEALATQEETPLSLRAFVRQRTRWDQG
FT                   FIQVLRKGSWRKLPWRRRALALFTLAAPFQQALTGVLIPVAMLAWGLTRRLPVDLVLFA
FT                   FLSLFAELGALSFEVIAAARLRRLRGERPRIRDALSLVLGLIPYQLVLVTALLVALVRE
FT                   LRGERGWAKTEHVGAHRRLSTPDEVLSEQQVA"
FT                   /protein_id="YP_003108714.1"
FT   misc_feature    complement(63550..64248)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Afer_0070"
FT   misc_feature    complement(order(63967..63969,63973..63975,64141..64143,
FT                   64219..64221,64225..64227))
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Afer_0070"
FT   gene            65218..68322
FT                   /db_xref="GeneID:8322119"
FT                   /locus_tag="Afer_0071"
FT   CDS_pept        65218..68322
FT                   /locus_tag="Afer_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fal:FRAAL5406 glycine-rich cell wall
FT                   structural protein precursor (partial match)"
FT                   /db_xref="GI:256370891"
FT                   /db_xref="GeneID:8322119"
FT                   /translation="MRRWAGVPVVKKLASIGAGLGLVGAGLSVPLTHAALAGSNSSSET
FT                   FYYTGSQQTFTVPMGVTQLDYTVAGGAGGAGYAALAGELGGSGGDGSVVTGTLTVTPGE
FT                   QLIIEVGSSGANASSNQQSCGGPFSLYVGGAGGSNPDSSFSGGSGGDGNCDLFNSGGGG
FT                   GGGGAASAILDSSNAALVVAAGGGGGGGAGAAAGYDGGAGGANASGGPGGGDGAGSGGQ
FT                   IGAAGSSAGGTGGYDDVAGHESGGGGGGGGGLDGGDGGSAGQIGGGGGGGGGSGSSTTG
FT                   SGVTVSATNNGNGYVTLSWSTSPPPPALSATLSATSSPSPAYAGDTVSFAVHVSGSGSS
FT                   SPVTGEAFIEAPGKTDQTEFIPVAEVPISDGAGTVQESVDQVAAVLEAEGESVPYGTLT
FT                   LPVYFIGSGAWQGVGATGSVGVDLSIDPTTTSLSLQPSSPVVGQPVTLTATVTNQSQAA
FT                   PGLPPTGSVTFSATDSAGTTTKLGTASVDGSGQATLSGLELPAGADTITASYSGDPTHD
FT                   ASSTTSSIDVSNALALFASSTPYPAYFGNDVAVTATVAGGGSLGAATGTACIEGPSGGV
FT                   TLGCFVVDQGSGSFTIPVEEAATLLGASRAYGPRALPVTFTGSGAWQGVDLTGSVNVDL
FT                   SLDPTTTNLSVQPSSPVARQPETLVATVTNQSQAAPGLPPTGSVTFSATDSAGTTTRLG
FT                   TSTLSSSGQAILTGISLPAGVHVVTASYSGDPTHDASSASSTIVVTTPVRLDLAASPTS
FT                   SSFGSAETLTATVHGQARGSVTFSLIQGRKTKRLGTAPVTSGHTAQLVTSNLPVGTDEI
FT                   VATYTPSSGSDVAPAYADTTLVVVQDVPAITILGPTSVAAGSSASYTILVTANGSPVDG
FT                   GTLLVQLGDTSSTATVDANGLATVTLTFPRTGGTQVLSAMYLGSPTVAMASNTLSVTVT
FT                   SPSPSTSAQSSSTPPAGSSSSSSTTTASSTSTSTSPTSPGTTSSTSTQAVRPVTASSAV
FT                   TVPTASTGEPFASPWWWALSGFGVGTGSTLAAVQIRRRRNTREAV"
FT                   /protein_id="YP_003108715.1"
FT   gene            68987..72292
FT                   /db_xref="GeneID:8322120"
FT                   /locus_tag="Afer_0072"
FT   CDS_pept        68987..72292
FT                   /locus_tag="Afer_0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /codon_start="1"
FT                   /product="transcriptional activator domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional activator domain; KEGG:
FT                   mva:Mvan_1815 transcriptional regulator"
FT                   /db_xref="GI:256370892"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="GeneID:8322120"
FT                   /translation="MRQPMGAYGRSATGRRTGGPRVKVRVLGQPRVETSLGSIAVGGQR
FT                   AKFLVGLAAAGGVLSVEEAATLLWPSVRPPSWRGALRVLVHELRDAFSRVGAPRGLVQR
FT                   SGPIFVLDTGDGEVDVDLWFARDAARDGRAAWEAGDFVTARARAEDVESILAEGVLPGL
FT                   DDEAVRDLRGGVTAERIRNLEVLARSAAALGDCSSALETVEGALGLDPTNQPLCQVGLM
FT                   AAETLGAVARGLALYARLRAALASGLGVSPSPALAASYARLIAAQGGQARGADEPHSLP
FT                   EAMRSRHRVVGRTTELAHLGVLWGRVERGEGLASVVVGPAGIGKTALLGELGAVVVSRG
FT                   GRVLYGRESDPPSHELAAIVEALRAYQTRCARVGVPCNLGPLGADLETLLGSGSDNVRL
FT                   APRSRRLRLSQAVRGWWAAVGSERPTLVVLDDLHWASATTTAILADLAVDGPPEGVLVV
FT                   GAARSTGSALPPSIGSLVSWGARTIELGPLALDAVADLLGSTGHDAARVAAEVWLASGG
FT                   NPERVWELAELVVNPGARGRSGLARLDVDRLSPPARRIVRAAAVLGRATPASVVFDVAD
FT                   TDDVAALQEAQAAGVLGLSQGGSVVLRHDLLREDVLAQAGTDEKVRLHARAAEALAKGG
FT                   TSSHTLVHHLARAAPVVSPERLAKARLSAAREAASLGAYEDALSALDAWRVERSDGGAD
FT                   DLDALVLRVECLSALGDPRLRDAVVELLERAVVLRRIAAAATAAEIVTAALIPTLVGRE
FT                   DPAITTRLQAALERARRPEHIASLASALALSRVWTASARDRRALARRAVAALDRRGGQG
FT                   ADALALATLTRAHLGSLEAAHPAHRLASARRILALARSTHDIEGVARGHLLAHDALVEL
FT                   GHLDEADLELQAARLCAAALDDQVRWEVEIREAGRRLMAGRLRDAEAAAEQALVTVRAE
FT                   ILREGAAAVYGAQLMMVREAEGRLGELADAVAEFRRVQHEWTVWDAAEARIAVALGDQG
FT                   RARELLARGVAELEDPVRTDITWLARAVQYAWVAGDVRDVEMAQRLVALLAPYRGTVHW
FT                   SVCVSLGPVDLLLARLLMLADPRRASTPLERARRLLANDGLAYWRARLADLVS"
FT                   /protein_id="YP_003108716.1"
FT   misc_feature    69047..>69640
FT                   /note="DNA-binding transcriptional activator of the SARP
FT                   family [Signal transduction mechanisms]; Region: DnrI;
FT                   COG3629"
FT                   /db_xref="CDD:33428"
FT                   /locus_tag="Afer_0072"
FT   misc_feature    69854..>70543
FT                   /note="Predicted ATPase [General function prediction only];
FT                   Region: COG3899"
FT                   /db_xref="CDD:33687"
FT                   /locus_tag="Afer_0072"
FT   gene            72700..73662
FT                   /db_xref="GeneID:8322121"
FT                   /locus_tag="Afer_0073"
FT   CDS_pept        72700..73662
FT                   /locus_tag="Afer_0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /codon_start="1"
FT                   /product="peptidase C60 sortase A and B"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   met:M446_5133 peptidase C60 sortase A and B"
FT                   /db_xref="GI:256370893"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="GeneID:8322121"
FT                   /translation="MASLGFVLAGLGTAGIVWPVTWLQHAEARGTVSIRRVVRSECDAV
FT                   PAGAIGVLAIPSVGVVAPVAQGLAQATLAWAVGHDPSTPLPGELGVSVLAAHDVSYFAS
FT                   NATLRRGAAVLYAQGCRTYVFTVADRLVLHPGQLIPPPGPRGLALDSCWPSDALFLTPD
FT                   RLIVTARLVAITRGDRLTLASTGVTPSLPAGVPQPPNLFASGWLGGTLTILGAASVRWR
FT                   DSRAPMAWEAEALASLSAARVGLAQDARWTSLVVAAGTVRTGLLLAPYTSGTPVSVREV
FT                   VLGDRVLSVAVTVTLGGNPLTVTEVPSAGTLRIVSVDPV"
FT                   /protein_id="YP_003108717.1"
FT   misc_feature    72847..73212
FT                   /note="Sortases are cysteine transpeptidases, found in
FT                   gram-positive bacteria, that anchor surface proteins to
FT                   peptidoglycans of the bacterial cell wall envelope. They do
FT                   so by catalyzing a transpeptidation reaction in which the
FT                   surface protein substrate is...; Region: Sortase; cl09098"
FT                   /db_xref="CDD:164119"
FT                   /locus_tag="Afer_0073"
FT   misc_feature    order(72904..72906,72940..72942,72976..72978,72982..72984,
FT                   72988..72990,73150..73155,73180..73182,73189..73191)
FT                   /note="active site"
FT                   /db_xref="CDD:99708"
FT                   /locus_tag="Afer_0073"
FT   misc_feature    order(72988..72990,73153..73155,73189..73191)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99708"
FT                   /locus_tag="Afer_0073"
FT   gene            complement(74290..75141)
FT                   /db_xref="GeneID:8322122"
FT                   /locus_tag="Afer_0074"
FT   CDS_pept        complement(74290..75141)
FT                   /locus_tag="Afer_0074"
FT                   /gene_family="HOG000046515" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /codon_start="1"
FT                   /product="Patatin"
FT                   /transl_table="11"
FT                   /note="PFAM: Patatin; KEGG: mmi:MMAR_2150 alpha-beta
FT                   hydrolase superfamily esterase"
FT                   /db_xref="GI:256370894"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="GeneID:8322122"
FT                   /translation="MRDEQHELTAFVFAGGGGRGACHVGMLRALFEAGVRPDLVVGASV
FT                   GALNGVIVAADPTSRSVERLESIWQSLRAARLFPATKLVTLLRYATRRASVFPAEPLMT
FT                   FIAAHVPVVDLADTTVPMELVLADPRTGEARWERQGPAVALLYGSAAIPGVLPPLVHDG
FT                   REWVDGGVLHDTPVARAADLGATRIVVLLTGTLADPLPVHERPLEALVRSITLTKRAQL
FT                   ATELAWARERAEVIVLECPAANALDALDFSQTSTLIESGYRTAVRTLAASLEGTPAREA
FT                   AR"
FT                   /protein_id="YP_003108718.1"
FT   misc_feature    complement(74320..75117)
FT                   /note="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily [General function prediction only]; Region:
FT                   RssA; COG1752"
FT                   /db_xref="CDD:31938"
FT                   /locus_tag="Afer_0074"
FT   misc_feature    complement(<74569..75111)
FT                   /note="Hypothetical patatin similar to Z1214 protein of
FT                   Escherichia coli; Region: Pat_hypo_Ecoli_Z1214_like;
FT                   cd07209"
FT                   /db_xref="CDD:132848"
FT                   /locus_tag="Afer_0074"
FT   misc_feature    complement(order(74638..74640,75010..75012,75085..75087,
FT                   75091..75096))
FT                   /note="active site"
FT                   /db_xref="CDD:132848"
FT                   /locus_tag="Afer_0074"
FT   misc_feature    complement(75004..75018)
FT                   /note="nucleophile elbow; other site"
FT                   /db_xref="CDD:132848"
FT                   /locus_tag="Afer_0074"
FT   gene            complement(75157..75684)
FT                   /db_xref="GeneID:8322123"
FT                   /locus_tag="Afer_0075"
FT   CDS_pept        complement(75157..75684)
FT                   /locus_tag="Afer_0075"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MarR; regulatory protein
FT                   Crp; SMART: regulatory protein MarR; KEGG: esi:Exig_2989
FT                   MarR family transcriptional regulator"
FT                   /db_xref="GI:256370895"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="GeneID:8322123"
FT                   /translation="MASSPDSDASRTLDELLFRLGQSLRRLRVSSGEHATFTYAIGAGF
FT                   WQLVAIAHHGEIRVSDLATQLNLDISTVSRQLKALAHRGLIEKVADAEDARVAKVRLTP
FT                   SGKQVLEELRARRHAVLERALQNWGPDRREMLLALLADLVRELDVASSCANCGSDDERT
FT                   KGPQTAKDTPTS"
FT                   /protein_id="YP_003108719.1"
FT   misc_feature    complement(75301..75543)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Afer_0075"
FT   gene            75804..77180
FT                   /db_xref="GeneID:8322124"
FT                   /locus_tag="Afer_0076"
FT   CDS_pept        75804..77180
FT                   /locus_tag="Afer_0076"
FT                   /gene_family="HOG000121942" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /codon_start="1"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   fra:Francci3_0279 pyridoxal-dependent decarboxylase"
FT                   /db_xref="GI:256370896"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="GeneID:8322124"
FT                   /translation="MHRLDDELRSLQASIVRYAMERIALQPPPLDGPKSADELRALYGA
FT                   NVTEDGIGGEEALRRFVEGYAPATLSSDHPRFLAFVPVAPTKAAVLFDMIVSASSISGT
FT                   SWLEGAGAVYLENEALRWLADLIGFPETAGGTFLSGGSLANLSGLHAARQAAKERLGGV
FT                   RPDRYRILASTEAHSSIRTAADVMDLEVVEVEVNDPGRLRGEDLVRTWAKLTDAERNSV
FT                   VAVVATAGTTNAGLVDALDEVADFAEVNGLWMHVDAAYGGAALASHLRERFRGIERAGS
FT                   VVIDPHKWLFAPFDAAAIVYRDPNVARRALTQEAAYLDEINRAPDWNPSSYGYHLSRRV
FT                   RGLPFWFSLATHGTRRYREAIEASITLAHESAHEIERRPYLELAIEPELSVVVFRRLGW
FT                   DAEAYERWSRQALVDGVGFVLPTAYRGEKLLRFCFVNPLTTLDDVRAILDTLAIDPRPW
FT                   "
FT                   /protein_id="YP_003108720.1"
FT   misc_feature    75861..77132
FT                   /note="Glutamate decarboxylase and related PLP-dependent
FT                   proteins [Amino acid transport and metabolism]; Region:
FT                   GadB; COG0076"
FT                   /db_xref="CDD:30425"
FT                   /locus_tag="Afer_0076"
FT   misc_feature    76032..77156
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Afer_0076"
FT   misc_feature    order(76224..76229,76236..76238,76485..76487,76572..76574,
FT                   76581..76583,76656..76658,76665..76667)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Afer_0076"
FT   misc_feature    76665..76667
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Afer_0076"
FT   gene            77177..77593
FT                   /db_xref="GeneID:8322125"
FT                   /locus_tag="Afer_0077"
FT   CDS_pept        77177..77593
FT                   /locus_tag="Afer_0077"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /codon_start="1"
FT                   /product="histidine triad (HIT) protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   pna:Pnap_4872 histidine triad (HIT) protein"
FT                   /db_xref="GI:256370897"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="GeneID:8322125"
FT                   /translation="MRAVSCPLCGAAASALRRSTLAAVVADRYPVAAGHLLVLPLRHCG
FT                   RLVDLDDEERADLWALVHDTLDAPPPVVGEADGWTVGVNDGAAAGQVIDHVHVHLIPRR
FT                   AGDVSDPRGGVRWVLGAKAPWWDDVGVDDASRHR"
FT                   /protein_id="YP_003108721.1"
FT   misc_feature    77246..77497
FT                   /note="HIT family: HIT (Histidine triad) proteins, named
FT                   for a motif related to the sequence HxHxH/Qxx (x, a
FT                   hydrophobic amino acid), are a superfamily of nucleotide
FT                   hydrolases and transferases, which act on the
FT                   alpha-phosphate of ribonucleotides. On the...; Region:
FT                   HIT_like; cl00228"
FT                   /db_xref="CDD:174049"
FT                   /locus_tag="Afer_0077"
FT   misc_feature    order(77249..77251,77255..77257,77279..77281,77285..77287,
FT                   77426..77428,77453..77455,77465..77467,77471..77473)
FT                   /note="nucleotide binding site/active site; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Afer_0077"
FT   misc_feature    order(77459..77461,77465..77467,77471..77479)
FT                   /note="HIT family signature motif; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Afer_0077"
FT   misc_feature    77465..77467
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Afer_0077"
FT   gene            complement(77770..78975)
FT                   /db_xref="GeneID:8322126"
FT                   /locus_tag="Afer_0078"
FT   CDS_pept        complement(77770..78975)
FT                   /locus_tag="Afer_0078"
FT                   /gene_family="HOG000249874" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: saq:Sare_2891 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:256370898"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8322126"
FT                   /translation="MAEAKGLHHKVVIIGGGSAGITVAARLRRAGETDVAIIEPSENHY
FT                   YQPLWTVVGGGLAKASETVRSEASVMPRGVKWIRDRVVTIDPENQVVSTESDIPVHYDY
FT                   LVVCPGIQLNWDRVPGLTEAVGHDGVSSNYTFDLAPRTWDFIQRTRSGTAVFTMPSGPI
FT                   KCAGAPQKIAYLAADYWRIEGVLDKIHVILVLPGPTMFGVPVWAKELEKVVARYGIDVR
FT                   FQSEMVEIDGTKREVVISDNKEGTKETISYDFLHAVPPQSAPDWLKATPLSDGTPGGCV
FT                   EVNKETLQHVRYPNVFALGDAGNTPNAKTGAAVRKQAPVVVANLKAVMAGRTPEAHYDG
FT                   YGSCPLVTARNRMLLAEFDYTGNPHPTVPLIDTTKEHYSMWLLKRYGLPALYWHGMLKG
FT                   IA"
FT                   /protein_id="YP_003108722.1"
FT   misc_feature    complement(77893..78945)
FT                   /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
FT                   [General function prediction only]; Region: HcaD; COG0446"
FT                   /db_xref="CDD:30795"
FT                   /locus_tag="Afer_0078"
FT   misc_feature    complement(<78862..78945)
FT                   /note="Anaerobic glycerol-3-phosphate dehydrogenase [Amino
FT                   acid transport and metabolism]; Region: GlpB; cl10040"
FT                   /db_xref="CDD:175070"
FT                   /locus_tag="Afer_0078"
FT   gene            complement(79073..79510)
FT                   /db_xref="GeneID:8322127"
FT                   /locus_tag="Afer_0079"
FT   CDS_pept        complement(79073..79510)
FT                   /locus_tag="Afer_0079"
FT                   /gene_family="HOG000004470" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   spe:Spro_1762 CoA-binding domain-containing protein"
FT                   /db_xref="GI:256370899"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="GeneID:8322127"
FT                   /translation="MIVIGAEQPIDVLRSVHTIAMVGASSNPWRASHHVMAELLDLGYE
FT                   VLPVNPRETMVHDLPAYPTLEAAAAEHSIDLVDVFRRPEACPAVARAAVGVGARALWLQ
FT                   LGIVSDEAAAIAREGGLIVVMDDCPSRYVTRLRADRRPEST"
FT                   /protein_id="YP_003108723.1"
FT   misc_feature    complement(79100..79492)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Afer_0079"
FT   gene            complement(79510..80421)
FT                   /db_xref="GeneID:8322128"
FT                   /locus_tag="Afer_0080"
FT   CDS_pept        complement(79510..80421)
FT                   /locus_tag="Afer_0080"
FT                   /gene_family="HOG000136697" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /codon_start="1"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: nca:Noca_1946 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="GI:256370900"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="GeneID:8322128"
FT                   /translation="MQIVVPTALTELITRIPDAPIVTWDPGDPIDDRLAMTTFFVPAYA
FT                   AGGAALEPLPRMRHLEVLQLLTAGVDRVVGQIGEGVTLCNARGVHDDATAELAVALLLA
FT                   ATRGLSEFALAQHEGRWERRVMPSLAGARVAIIGYGAIGRAIEARLAPFGVEIVRVART
FT                   PRFNPDVLAFDEFAPILPTLAGIVVVVPLTDATRHLIDAALLARLPDGAVVVNVARGPV
FT                   VDTEALVAELASGRLRAGLDVTDPEPLPPFHPLWHLPNVVLTPHVGGDVAGLETRASAL
FT                   VERNVRRYMAGLPLLNVVRGEY"
FT                   /protein_id="YP_003108724.1"
FT   misc_feature    complement(79525..80418)
FT                   /note="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; Region: 2-Hacid_dh; pfam00389"
FT                   /db_xref="CDD:144107"
FT                   /locus_tag="Afer_0080"
FT   misc_feature    complement(79618..80106)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Afer_0080"
FT   gene            complement(81088..83178)
FT                   /db_xref="GeneID:8322129"
FT                   /locus_tag="Afer_0081"
FT   CDS_pept        complement(81088..83178)
FT                   /locus_tag="Afer_0081"
FT                   /gene_family="HOG000086348" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /codon_start="1"
FT                   /product="Peptidase S53 propeptide"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S53 propeptide; KEGG: cac:CAC0625
FT                   periplasmic aspartyl protease"
FT                   /db_xref="GI:256370901"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="GeneID:8322129"
FT                   /translation="MRRISRRLQMLGTLGSIGLVGAALAMPGAQSLASASDPLVPVSQG
FT                   IGADVLSHATPTGTTAGSTMMRVSFILKMRNQGQLASRVAAGWRGPYLTPHEFALEYGQ
FT                   TEEYILALRGFLREFGISSQAMSDGLDVTSQGTAAQYDKALGILLENFTVTTRPAASAP
FT                   ATTQTVYGTRSAPQMPLNLASNILAVLGLSNYAPYESLAVPGINQVAPTAGSSQTAAPT
FT                   DQLPQAFTSDYNLTPLQQAGYLGQGQTIGIVTLASVNPSVPMYFWRNIAHVVTLPNRLA
FT                   LVNVDGGAGPVSLNAGSDETTLDVEQSGTIAPMAKIVVYQAPNTDYGFVDAFYEAASQN
FT                   VAGSVSSSWGESETAIQAAVDAAQESPGYAASFNQAFLEMAAQGQSNFIASGDNGAYDP
FT                   QGDIGTTNLGIDNPSDSPYDTAAGGTTLPGTQTYPIMANGTQVGTESVTIPQQMTWGWD
FT                   YLWPMYIALGFQNEAQAATSLPVGSGGGYSTLFGRPLYQQGQMVGAGSYSAYEFLTPID
FT                   PQQVAPGLVEPTQFSFNPAPTLQTGMSGGRVTPDLAFNADPQTGYAVYDPQFQSVYGSK
FT                   LVDFGGTSFIAPQLNGTDAVYESALGGVRLGFWNPNIYRFATSTSSPFTPLDSNTIDGS
FT                   AYYSGQIGNAQLAISGEFTNTNDFYTGSQGAVFNPGSGLGYADLTQLFRSFQTAIPREL
FT                   GD"
FT                   /protein_id="YP_003108725.1"
FT   misc_feature    complement(82594..83025)
FT                   /note="Pro-kumamolisin, activation domain; Region:
FT                   Pro-kuma_activ; pfam09286"
FT                   /db_xref="CDD:150076"
FT                   /locus_tag="Afer_0081"
FT   misc_feature    complement(81262..82482)
FT                   /note="Peptidase domain in the S53 family; Region:
FT                   Peptidases_S53; cd04056"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Afer_0081"
FT   misc_feature    complement(order(81427..81429,82000..82005,82009..82011,
FT                   82126..82137,82267..82269,82279..82281))
FT                   /note="active site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Afer_0081"
FT   misc_feature    complement(order(81427..81429,82267..82269,82279..82281))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Afer_0081"
FT   misc_feature    complement(81298..81303)
FT                   /note="calcium binding site; other site"
FT                   /db_xref="CDD:173788"
FT                   /locus_tag="Afer_0081"
FT   gene            complement(83357..84634)
FT                   /db_xref="GeneID:8322130"
FT                   /locus_tag="Afer_0082"
FT   CDS_pept        complement(83357..84634)
FT                   /locus_tag="Afer_0082"
FT                   /gene_family="HOG000018071" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:6.1.1.21"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.21"
FT                   /transl_table="11"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   cms:CMS_2457 histidyl-tRNA synthetase"
FT                   /db_xref="GI:256370902"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="GeneID:8322130"
FT                   /translation="MLQVRPFRGMRDILPGEHEVRSAAASVIRSTYRSHGFLEIETPIV
FT                   ETLEALAASGAGENAKLMFKVLKRGERLDLGSASSPDDLVDAGLRFDLTVPLARFYAVN
FT                   QSKLPKPFLAMQIGPAFRAERPQRGRLRQFVQADADILGEASWLAEVELLIAATAALHQ
FT                   LGLEGFELHVNDRRAVEHVLERLEVPADHWRSVLVALDKLDKEPPIAVRNEMVGAGLGE
FT                   ELADHVLATLGDIVENEHPLDVLETLDVDASVLESLHAIATHVRTSVRDTEVVIDPLIV
FT                   RGLDYYSSSVFEIVHPHWSSSIGGGGRYDGLLARFGVDEPACGISLGFERILSLLEELG
FT                   IHLATPRRRLTLIFDPTTQIAEALRMARHFRRDGYLVTLLPHDHTARSPMKRLALAAEE
FT                   LKAEGSQDSFWHLTLGVDAEPRLLMH"
FT                   /product="Histidine--tRNA ligase"
FT                   /protein_id="YP_003108726.1"
FT   misc_feature    complement(83459..84622)
FT                   /note="histidyl-tRNA synthetase; Region: hisS; TIGR00442"
FT                   /db_xref="CDD:161881"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(83624..84586)
FT                   /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
FT                   catalytic core domain. HisRS is a homodimer. It is
FT                   responsible for the attachment of histidine to the 3' OH
FT                   group of ribose of the appropriate tRNA. This domain is
FT                   primarily responsible for ATP-dependent...; Region:
FT                   HisRS-like_core; cd00773"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(order(83660..83665,83714..83716,84170..84172,
FT                   84179..84181,84191..84193,84215..84217,84236..84241,
FT                   84323..84328,84335..84340,84353..84355,84359..84361,
FT                   84434..84439,84500..84520,84533..84535,84569..84571))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(84500..84526)
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(order(83642..83644,83651..83653,83660..83662,
FT                   83714..83716,83729..83731,83774..83779,83783..83785,
FT                   83789..83791,84215..84217,84227..84229,84233..84235,
FT                   84242..84244,84263..84265,84269..84271,84353..84355,
FT                   84359..84361))
FT                   /note="active site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(84260..84274)
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   misc_feature    complement(order(83642..83644,83651..83665))
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Afer_0082"
FT   gene            84769..85296
FT                   /db_xref="GeneID:8322131"
FT                   /locus_tag="Afer_0083"
FT   CDS_pept        84769..85296
FT                   /locus_tag="Afer_0083"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03640"
FT                   /codon_start="1"
FT                   /product="secreted repeat of unknown function"
FT                   /transl_table="11"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   ace:Acel_0027 hypothetical protein"
FT                   /db_xref="GI:256370903"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="GeneID:8322131"
FT                   /translation="MRKSLHVRSVVTVGVLASLGVVLAACGSTSSTSTSAKTSSSSATV
FT                   ATSSSSYGTIVTSGSGVTYYVFSADSHDHSACTGSCAAAWHPVLATHPTVGGSAQASLV
FT                   STFVRPGGEHQVAYDGHPLYTFVDDSGPHVISGQGINSFGGSWHVIAPSGTPITAASSS
FT                   SSSSSSGYSSGY"
FT                   /protein_id="YP_003108727.1"
FT   misc_feature    84925..85032
FT                   /note="Secreted repeat of unknown function; Region:
FT                   Lipoprotein_15; pfam03640"
FT                   /db_xref="CDD:112457"
FT                   /locus_tag="Afer_0083"
FT   misc_feature    85078..85221
FT                   /note="Secreted repeat of unknown function; Region:
FT                   Lipoprotein_15; pfam03640"
FT                   /db_xref="CDD:112457"
FT                   /locus_tag="Afer_0083"
FT   gene            85398..87116
FT                   /db_xref="GeneID:8322132"
FT                   /locus_tag="Afer_0084"
FT   CDS_pept        85398..87116
FT                   /locus_tag="Afer_0084"
FT                   /gene_family="HOG000276949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /codon_start="1"
FT                   /EC_number="3.5.4.2"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_0699 adenine deaminase; TIGRFAM:
FT                   adenine deaminase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="GI:256370904"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:8322132"
FT                   /translation="MRSASPRHDSHMIALARGDGNVDLVINGAEVFSPLTRTWVSTSLA
FT                   IADGVVVGWGERPTKERLDLAGMIIVPGFIDAHVHIESTKLWIDRFVEATVPMGTVAVA
FT                   SDPHEMANVKGLEGVRAMIAAAHDLPITIGVCGSSCVPASRFESPGATFEVEAIAEVLA
FT                   ETDALGVAEVMDFPGVIAGDETLLAKIALAGSRRVDGHAPGLRGSDLDAYLVAGVESDH
FT                   EMVSLEEVDEKRHKGMWVFLRHGSASHNLAAFAPSVRAYGTTNVALCSDDREPDLLLER
FT                   GHVNDLVRIALEAGISLEDALVLATLNPATYHGLTHLGHLGPGRQADFVVYRSRAELEA
FT                   GRPPAMVFHRGRLVAEDGRLVVELPRREVPETLLATVRLARALVEGDFTTPIPERVRVI
FT                   VANDHSLWTNQRVTTRDELTGINRLAVVERHHATGRIGHGLVEGFGLERGAIASTVAHD
FT                   AHNLMVVGALGAEADMATAANRVAALGGGQVVVVDGQVIAEVPLPIAGLMSDAPIAETA
FT                   RAVVEATQAAHALGSTLEAPFMTLAFLGLSVIPELKLTDQGLVDVGAWDVVSLEA"
FT                   /product="adenine deaminase"
FT                   /protein_id="YP_003108728.1"
FT   misc_feature    85428..87113
FT                   /note="Adenine deaminase [Nucleotide transport and
FT                   metabolism]; Region: AdeC; COG1001"
FT                   /db_xref="CDD:31205"
FT                   /locus_tag="Afer_0084"
FT   misc_feature    85464..>85670
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="Afer_0084"
FT   misc_feature    85587..>86465
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="Afer_0084"
FT   misc_feature    order(85629..85631,85635..85637,85998..86000,86061..86063,
FT                   86208..86210)
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="Afer_0084"
FT   misc_feature    <86652..87080
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="Afer_0084"
FT   gene            87173..88348
FT                   /db_xref="GeneID:8322133"
FT                   /locus_tag="Afer_0085"
FT   CDS_pept        87173..88348
FT                   /locus_tag="Afer_0085"
FT                   /gene_family="HOG000012240" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.16"
FT                   /transl_table="11"
FT                   /note="KEGG: rrs:RoseRS_2545 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="GI:256370905"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:8322133"
FT                   /translation="MRDAVIVDVVRTPVGRRNGALSGWHAVDLASTVLEALVARTGIDP
FT                   ALVEDVIMGCVSQVGEQGINVARNAVLAAGFPESVPGTTVDRQCGSSQQAVAFAAQGVL
FT                   AGAYDVVIAAGVESMSRVPMGSNGVGPGSPFGPRVEARYAARGGLVPQGISAELIVERW
FT                   GLTRQELDAFALRSHERAWTATTEGRFKSEILPIEGRRADGAAAPTVLEADEGIRPDTS
FT                   LEALGSLKPAFVPTGTVTAGNASQISDGAAAALIMDAERARRLGLVPRARVVAFSLAAD
FT                   DPIMMLTAPIPATRRVLERAHLSLDDIDLVEINEAFASVVLAWGAELHPDWDRVNVNGG
FT                   AIALGHPLGASGARLLATLVNELERRGGRYGLQTMCEGGGMANALVIERLG"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /protein_id="YP_003108729.1"
FT   misc_feature    87173..88342
FT                   /note="acetyl-CoA acetyltransferase; Provisional; Region:
FT                   PRK06504"
FT                   /db_xref="CDD:168584"
FT                   /locus_tag="Afer_0085"
FT   misc_feature    87185..88339
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Afer_0085"
FT   misc_feature    order(87239..87241,87320..87322,87365..87367,87374..87376,
FT                   87386..87388,87419..87430,87452..87454,87473..87478,
FT                   87485..87487,87530..87532,87998..88000,88004..88006,
FT                   88010..88012,88070..88072,88307..88312)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Afer_0085"
FT   misc_feature    order(87437..87439,88208..88210,88298..88300)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Afer_0085"
FT   gene            88349..88942
FT                   /db_xref="GeneID:8322134"
FT                   /locus_tag="Afer_0086"
FT   CDS_pept        88349..88942
FT                   /locus_tag="Afer_0086"
FT                   /gene_family="HOG000025029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mem:Memar_0072 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="GI:256370906"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="GeneID:8322134"
FT                   /translation="MSAPRVLIVDNVDSFVHNLYQYVGELGADPVVVRDLEIRDRVDPR
FT                   SFDAIIISPGPGHPRACVGGRWILEDAAREVPTLGVCLGHQLIGLVFGATVTHAPRIVH
FT                   GETSSVRHDGRGVFAGLPNPLVATRYHSLAIDPTSVPDELVVTSWSEDDVIMGVRHRSF
FT                   PIEGIQFHPESYATDLGHQLIGRFLGLEVPARTR"
FT                   /protein_id="YP_003108730.1"
FT   misc_feature    88364..88912
FT                   /note="Type 1 glutamine amidotransferase (GATase1) domain
FT                   found in Anthranilate synthase; Region:
FT                   GATase1_Anthranilate_Synthase; cd01743"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Afer_0086"
FT   misc_feature    88367..88912
FT                   /note="Glutamine amidotransferase class-I; Region: GATase;
FT                   pfam00117"
FT                   /db_xref="CDD:143892"
FT                   /locus_tag="Afer_0086"
FT   misc_feature    order(88508..88513,88517..88519,88592..88597,88604..88606,
FT                   88736..88747)
FT                   /note="glutamine binding; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Afer_0086"
FT   misc_feature    order(88592..88594,88859..88861,88865..88867)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Afer_0086"
FT   gene            complement(89146..91083)
FT                   /db_xref="GeneID:8322135"
FT                   /locus_tag="Afer_0087"
FT   CDS_pept        complement(89146..91083)
FT                   /locus_tag="Afer_0087"
FT                   /gene_family="HOG000037185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   rxy:Rxyl_0021 serine/threonine protein kinase"
FT                   /db_xref="GI:256370907"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:8322135"
FT                   /translation="MTEEVQLQVFGTRYQPIAKIARGGMADVYEARDLLLDRLVALKVL
FT                   FAELSTNPTFVERFRREAQSAAALSHPNIVSVYDWGPANGTYFIAMELVSGQTLAQLIR
FT                   TVGVVPPDQAASIGADVALALAFAHRHGVVHRDIKPSNVLITEDGIVKVADFGIARAVA
FT                   NDEDLTQTGSVLGTATYISPEQARGEDLDGRSDIYSLGIVLYEMLTGTPPFLGETPIAV
FT                   AYKHVTEAPTPLRNVNPRVSAELETVVMRCLAKQRDQRYPDATALRVDLQRVLEHRPLR
FT                   TTTTQTALGERTMAIGAVEGVGDRTQLLSRVEDTASIPAVTPPVETARRRRRWPWILLV
FT                   IVVLLALAGGLLYAKLAGSNHHVAAPLPRVAVPNVVGSQEQGAAQVLSNLGLQSALSFR
FT                   AASASSGTVIAESPRAGTKVQKGSTVDLVVSSGPAAVTVPKVVGETASTAEAKLLALGF
FT                   NVSTNYQAASAPQGTVVAESPTGGTSAPHGSTVVLTVSNGPSSIAVPNVVGLSLASASN
FT                   KLGADQLAVGTVTYQASSSVPNGDVISTSPAPGTKVAPGSSVALVVSQGNEATVPNVVG
FT                   DPVATAEQDLTNAGFTYTLSQPNPPAAAVVESTSPAAGTQAPVGSSVTITWTTTASGGP
FT                   ASGGPTPSAG"
FT                   /protein_id="YP_003108731.1"
FT   misc_feature    complement(90283..91044)
FT                   /note="Protein kinase domain; Region: Pkinase; pfam00069"
FT                   /db_xref="CDD:143851"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(90283..90915)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(order(90547..90558,90610..90612,90619..90621,
FT                   90652..90654,90658..90663,90667..90669,90673..90675,
FT                   90784..90786,90790..90792,90802..90813,90859..90861))
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(order(90619..90621,90652..90654,90658..90663,
FT                   90667..90669,90673..90675,90790..90792,90802..90813,
FT                   90859..90861))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(order(90547..90558,90610..90612,90661..90663,
FT                   90667..90669,90673..90675,90784..90786,90790..90792))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(order(90547..90558,90604..90624))
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(89794..89970)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(89596..89775)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(89392..89574)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0087"
FT   misc_feature    complement(89206..89376)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0087"
FT   gene            complement(91136..92698)
FT                   /db_xref="GeneID:8322136"
FT                   /locus_tag="Afer_0088"
FT   CDS_pept        complement(91136..92698)
FT                   /locus_tag="Afer_0088"
FT                   /gene_family="HOG000037185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG:
FT                   kra:Krad_0072 protein kinase"
FT                   /db_xref="GI:256370908"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:8322136"
FT                   /translation="MTDESTAPLSLGRRDRGRRTRRDGQLHVFGTRYQPIAKIARGGMA
FT                   DVYEARDLLLDRLVALKVLFAELSTNPTFVERFRREAQSAAALSHPNIVSVYDWGPANG
FT                   TYFIAMELVSGQTLAQLIRTVGVVPPEQAASIGADVALALAFAHRHGVVHRDIKPSNVL
FT                   ITEDGIVKVADFGIARAVANDEDLTQTGSVLGTATYISPEQARGEDLDGRSDIYSLGIV
FT                   LYEMLTGTPPFLGETPIAVAYKHVTEAPTPLRNVNPRVSAELETVVMRCLAKQRDQRYP
FT                   DATALRVDLQRVLEHRPLRTTTTQTALGERTMAIGAVEGVGDRTQLLSSPASTTPPRRS
FT                   RRWPWLAIVLVVVLGLGVAIGVIASRLTAVAVVAVPRLRGMSEAAASNDLGADQLVLGT
FT                   VTTEASTTVPPGEVIATSPTADTTVAIRSRVNLIVSSGPPRVVVPTLQGLSVAAASNLL
FT                   GTHQLVLGTVSYQTSTTVPSGDVLASRPAAGTEVAPGSAVTLVIARAPAPTATAHAKRK
FT                   RSS"
FT                   /protein_id="YP_003108732.1"
FT   misc_feature    complement(91841..92602)
FT                   /note="Protein kinase domain; Region: Pkinase; pfam00069"
FT                   /db_xref="CDD:143851"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(91841..92473)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(order(92105..92116,92168..92170,92177..92179,
FT                   92210..92212,92216..92221,92225..92227,92231..92233,
FT                   92342..92344,92348..92350,92360..92371,92417..92419))
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(order(92177..92179,92210..92212,92216..92221,
FT                   92225..92227,92231..92233,92348..92350,92360..92371,
FT                   92417..92419))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(order(92105..92116,92168..92170,92219..92221,
FT                   92225..92227,92231..92233,92342..92344,92348..92350))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(order(92105..92116,92162..92182))
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(91394..91576)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0088"
FT   misc_feature    complement(91193..91375)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Afer_0088"
FT   gene            complement(92695..94176)
FT                   /db_xref="GeneID:8322137"
FT                   /locus_tag="Afer_0089"
FT   CDS_pept        complement(92695..94176)
FT                   /locus_tag="Afer_0089"
FT                   /gene_family="HOG000235771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /codon_start="1"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /transl_table="11"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: ace:Acel_0020 peptidoglycan glycosyltransferase"
FT                   /db_xref="GI:256370909"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="GeneID:8322137"
FT                   /translation="MRRRIGIVTLVLLLAFALVFVQLNNLQVVQASKLADAPGNTAGMQ
FT                   RIFSENRGPILTADGQVMAESVPLPGGNSYQRTYPAGSLYGDITGYFSLIYGLSGLEYE
FT                   LNRYLVPHVVVPDSISQLLGSSEQTDSVVTTINSRLQRTAYQALGSLKGAVIALDPRTG
FT                   AILALASNPTYDPAPLAAQSTTTEIAAWKADLANPGDPLLDRAISRAYPPGSTFKMVTT
FT                   SAIFDHDPKLALINFPAVSQIPLPETTHELHNYAYESCGGTLTQTLPVSCDTAFAQLGL
FT                   KLGATALSEEATAFGFNQVPPIDLPGAAASTFPPASFFKQNLPQLAFSAIGQGNVTATL
FT                   LQMALVGAGIANHGAIMTPHVLNRVLNPQDAVVTAYHPHVWRVATSPSTAAQVTQLMID
FT                   VVRYGTAVGIQIPGVQIAAKTGTAQTTLTSHSSVLGASDNWMVAFAPAENPRVVVAVVV
FT                   PKQPGLSANPTGAQYAGPVVKAMLEAALGITGGQG"
FT                   /protein_id="YP_003108733.1"
FT   misc_feature    complement(93850..>93972)
FT                   /note="Penicillin-binding Protein dimerization domain;
FT                   Region: PBP_dimer; pfam03717"
FT                   /db_xref="CDD:146381"
FT                   /locus_tag="Afer_0089"
FT   misc_feature    complement(92728..93720)
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="Afer_0089"
FT   gene            complement(94169..95437)
FT                   /db_xref="GeneID:8322138"
FT                   /locus_tag="Afer_0090"
FT   CDS_pept        complement(94169..95437)
FT                   /locus_tag="Afer_0090"
FT                   /gene_family="HOG000235782" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /codon_start="1"
FT                   /product="protein serine/threonine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Stage II sporulation E family protein; Protein
FT                   phosphatase 2C-like; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: nfa:nfa840 putative protein phosphatase"
FT                   /db_xref="GI:256370910"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="GeneID:8322138"
FT                   /translation="MQLRWAAASHTGRVRSSNQDAVAADGRSFVVADGMGGHVGGEVAS
FT                   SIAIRAIADAVAAGASAVDALRAANVAIFERSQDEPELAGMGTTATLAIVDPDGRCDLA
FT                   NVGDSRAYLLRAGELRQITNDHTFVQELVDAGTITSQQAQHHQARHVLTKVLGVVEGVE
FT                   PDHFELTLGPGDTLLLCSDGLVNEVTETEIAHLLSNDDPEHAVSALVEAALEHGGSDNV
FT                   SVIVVSAHEDGVPAGASSALGATSELSHARPADTASTSVVSEASRAASGRTRRSSSAPK
FT                   DPSLATKLPRPLPSQMTERPTWIRSALRLAALIVALGAVAAVVVGVVALYNDHSYIVTI
FT                   VAGHVVIERGRIGGILWFHPRVVETTSLQQRALTPALRLQLGHGVQEGSLAAARTLVAN
FT                   LTREAAQQHASLAAFGVVEVLHA"
FT                   /protein_id="YP_003108734.1"
FT   misc_feature    complement(94757..95422)
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cd00143"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Afer_0090"
FT   misc_feature    complement(order(94778..94780,94892..94894,95333..95341,
FT                   95378..95383,95393..95395))
FT                   /note="active site"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Afer_0090"
FT   gene            complement(95437..95949)
FT                   /db_xref="GeneID:8322139"
FT                   /locus_tag="Afer_0091"
FT   CDS_pept        complement(95437..95949)
FT                   /locus_tag="Afer_0091"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: cef:CE0038 hypothetical
FT                   protein"
FT                   /db_xref="GI:256370911"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:8322139"
FT                   /translation="MSVVLLTILKYALIVVIWIFFAFALRAVWRETRRAQRTPASVNAR
FT                   PVVASAGSGAQAEAHQTAARVTPSGGPKTGALVVLAVAGPLEGRRLELATPATIGRDAS
FT                   CDLTLADDRFVSGHHAEVVKEGRRIIVRDLGSTNGTFVNGERVEGSMRVTRGDVLQVGQ
FT                   SAFRVVG"
FT                   /protein_id="YP_003108735.1"
FT   misc_feature    complement(95446..95724)
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Afer_0091"
FT   misc_feature    complement(order(95533..95541,95599..95604,95608..95610,
FT                   95647..95649))
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Afer_0091"
FT   gene            complement(95954..96613)
FT                   /db_xref="GeneID:8322140"
FT                   /locus_tag="Afer_0092"
FT   CDS_pept        complement(95954..96613)
FT                   /locus_tag="Afer_0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: art:Arth_0026 FHA domain
FT                   containing protein"
FT                   /db_xref="GI:256370912"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:8322140"
FT                   /translation="MALEQFERRIASAVESIFSKGAPRGIEPAEIGRRLVREIERDVRI
FT                   GVRSEIAPNRIVVALAPSDLEELGPLRARVEEELAELARETVDDNGFELLGPIALTIDA
FT                   DPQLKAGTFYIDTAFVEDATYRNRWRFILPDGAPVELGPGSYIIGRQSGADVRIDDNRV
FT                   SRRHAEVTIAEGTATVTDLGSTNGTFVNGERVARPTELQAGDVLRLGAVEVRVERG"
FT                   /protein_id="YP_003108736.1"
FT   misc_feature    complement(96266..96607)
FT                   /note="Protein of unknown function (DUF2662); Region:
FT                   DUF3662; pfam12401"
FT                   /db_xref="CDD:152836"
FT                   /locus_tag="Afer_0092"
FT   misc_feature    complement(95963..96187)
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Afer_0092"
FT   misc_feature    complement(order(96053..96061,96119..96124,96128..96130,
FT                   96164..96166))
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Afer_0092"
FT   gene            96722..96808
FT                   /note="tRNA-Leu1"
FT                   /db_xref="GeneID:8322141"
FT                   /locus_tag="Afer_R0003"
FT   tRNA            96722..96808
FT                   /db_xref="GeneID:8322141"
FT                   /locus_tag="Afer_R0003"
FT                   /product="tRNA-Leu"
FT   gene            96927..97475
FT                   /db_xref="GeneID:8322142"
FT                   /locus_tag="Afer_0093"
FT   CDS_pept        96927..97475
FT                   /locus_tag="Afer_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SAV_5828"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sma:SAV_5828 hypothetical protein"
FT                   /db_xref="GI:256370913"
FT                   /db_xref="GeneID:8322142"
FT                   /translation="MVATSFVGELPDKTMIAAVILGRRHHPTKVVGAAVLGLGAQAAIA
FT                   VTLATVARRLLKASVVHQVSGAILLVVAAVLVWVALRAKEDAGDTITPNRPFWQLVGVF
FT                   FLAELGDVTQATTAGFALSSSEPVVVAVAATAGMTLAIAIGATASSALSRIPERAIWAS
FT                   AAAILILLGVGELTGVLIL"
FT                   /protein_id="YP_003108737.1"
FT   gene            complement(97465..99531)
FT                   /db_xref="GeneID:8322143"
FT                   /locus_tag="Afer_0094"
FT   CDS_pept        complement(97465..99531)
FT                   /locus_tag="Afer_0094"
FT                   /gene_family="HOG000249929" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02278"
FT                   /codon_start="1"
FT                   /product="bifunctional aldehyde dehydrogenase/enoyl-CoA
FT                   hydratase"
FT                   /transl_table="11"
FT                   /note="catalyzes the ring cleavage reaction in
FT                   phenylacetate degradation and the formation of
FT                   3-hydroxyacyl-CoA from crotonyl-CoA"
FT                   /db_xref="GI:256370914"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="GeneID:8322143"
FT                   /translation="MQTLGSFVEDSWWFSTDPGQPVLDATTGEEVARLATRGLPTEAMV
FT                   RFARDVGGPALRALGFQDRGALLGALGAYLSEHVDTLHDASAVAGATARDAWFDVEGGI
FT                   GVLYSYASLAKRSLPEGNVLRDGEVERLDRGGRFAGRHIFVPRRGVEVQINAFNFPVWG
FT                   PLEKLAPALLAGMPTIIKPASQTAPVTHRLVQLIIDSGLLPPGALQLVAGGAEDLLDHL
FT                   GPQDTIAFTGSAATAELLRSHPSVRTRGTHLTVETDSLNASILGPDAVPGTNEFDLYVS
FT                   QLVDELTIKAGQRCTAIRRALVPASLVGPVVEAATERLSAVTVGDPRRPDVVMGPLASL
FT                   AQRAEVRARIDELARAADVVVGGDLDDVLGADPERGAFVAPTLLVARDADRDEPHRIEA
FT                   FGPVATVLGYQDPQHAAKLAARGAGSLVASVVSADARVVDELVMELAPWHGRILVLDAT
FT                   SAPASTGHGSPLPRLLHGGPGRAGGGEELGGMRAVTRHLARTAVQGTPSVLGRIAAQWV
FT                   PGAPRHLGEHPFRKPTSALQLGDAISAGPRIVTADDIAAFAALSGDHFYAHTNPEAAAA
FT                   NPLFGGIVAHGYLVVSLAAGLFVDPEPGPVLANYGVDNLRFLTPVRPGDALSVTLTAKE
FT                   ITPRAGMPYDEVRWDAEVTRDGDGAIVARYDVLTMVARTWPLEADPEESAPRG"
FT                   /protein_id="YP_003108738.1"
FT   misc_feature    complement(97513..99531)
FT                   /note="bifunctional aldehyde dehydrogenase/enoyl-CoA
FT                   hydratase; Provisional; Region: PRK11563"
FT                   /db_xref="CDD:171171"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(97996..99522)
FT                   /note="NAD(P)+-dependent aldehyde dehydrogenase
FT                   superfamily; Region: ALDH-SF; cl11961"
FT                   /db_xref="CDD:176616"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(order(98107..98109,98254..98256,98332..98334,
FT                   98338..98340,98647..98649,98758..98766,98812..98817,
FT                   98824..98826,98833..98844,98980..98985,98989..98991,
FT                   99034..99036,99058..99072))
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(order(98647..98649,98656..98658,98764..98766,
FT                   99058..99060))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143395"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(97507..97929)
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:174252"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(order(97672..97683,97771..97776))
FT                   /note="active site 2"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="Afer_0094"
FT   misc_feature    complement(order(97699..97707,97735..97737,97744..97749,
FT                   97756..97758))
FT                   /note="active site 1"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="Afer_0094"
FT   gene            complement(99756..99847)
FT                   /note="tRNA-Ser4"
FT                   /db_xref="GeneID:8322144"
FT                   /locus_tag="Afer_R0004"
FT   tRNA            complement(99756..99847)
FT                   /db_xref="GeneID:8322144"
FT                   /locus_tag="Afer_R0004"
FT                   /product="tRNA-Ser"
FT   gene            100027..100710
FT                   /db_xref="GeneID:8322145"
FT                   /locus_tag="Afer_0095"
FT   CDS_pept        100027..100710
FT                   /locus_tag="Afer_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sai:Saci_2099 hypothetical protein"
FT                   /db_xref="GI:256370915"
FT                   /db_xref="GeneID:8322145"
FT                   /translation="MSWMRRHRVRLGLAALGAVLATGAGVATAAAASPPPSNAVVPGTG
FT                   VGEYGMTSAFYDGHIVHFTYSRGFYCDLHVSSGASSGCEVGANYVVPPSKSFDPLYIAV
FT                   PIGISVPAMSMDCPSGLVCVDHPGTIDLSRLEPALKPLYPNLSAAQLTAALKNVPTPGH
FT                   EHFITTVNDRKPEWWDVKVIGVEKLSVWNAINRHRSFAFLEKEVRAGQTTPIIPTNLFL
FT                   YFSVN"
FT                   /protein_id="YP_003108739.1"
FT   gene            100769..101734
FT                   /db_xref="GeneID:8322146"
FT                   /locus_tag="Afer_0096"
FT   CDS_pept        100769..101734
FT                   /locus_tag="Afer_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mab:MAB_0355 ammonium transporter"
FT                   /db_xref="GI:256370916"
FT                   /db_xref="GeneID:8322146"
FT                   /translation="MHLTRRRLQLGLGWLWLLDGCLSLQGSLLGKSFVTAVLEPTLAHQ
FT                   PAIVAAPLRTAIELVAPHAALAGLAIALVQLGLGLGLVVARDTRRWLALSIGWALVVWW
FT                   IGEGLGGLLTGATLLSGAPGAALLYALIAAAAWPRRGRQEHVPPSPFAVAAWSVLWIVN
FT                   GVAQVLADRSSTNPIASTAQMGQVGAPSWIAAVDQRLGTIHGDALGTMLIVLEVAVAIW
FT                   GLVPGGPRTLSALVGSGLAVVAWVFFQGMGALTSGLATDPNTGPLMLLLAGAVVAARPA
FT                   TGALTEAIGRRRERRAPVGAHVLLGVHRGERSSSIPAQTK"
FT                   /protein_id="YP_003108740.1"
FT   gene            complement(102441..102527)
FT                   /note="tRNA-Ser3"
FT                   /db_xref="GeneID:8322147"
FT                   /locus_tag="Afer_R0005"
FT   tRNA            complement(102441..102527)
FT                   /db_xref="GeneID:8322147"
FT                   /locus_tag="Afer_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(102542..103462)
FT                   /db_xref="GeneID:8322148"
FT                   /locus_tag="Afer_0097"
FT   CDS_pept        complement(102542..103462)
FT                   /locus_tag="Afer_0097"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.51"
FT                   /transl_table="11"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="GI:256370917"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="GeneID:8322148"
FT                   /translation="MPTHRVSYLGPTGTFTEEALRRSFGDRVEPVAYPTIEDVLEAVDH
FT                   GDVDLAFSPIENALEGAVLATLDALVHRFDLLAVAEAILPVHHQLLGVVGSSLDRITRV
FT                   LSHPQALSQSRGFLRTRLPGATRVAVASTAEAARTVADANDPTTAAIGTMTAAHLWHLD
FT                   VLASDIEDDPRNETRFWLLAKGRLPEPTGSDRTALACFQVTDRPGSLLALLSAFAARGI
FT                   NLTKLESRPTRTSLGAYLFVIELEGHVTDPAVASALDDLAASGVRAKLLGSFASARPRH
FT                   REEAAPSPPPVPLDPSLPRSLHSPD"
FT                   /product="Prephenate dehydratase"
FT                   /protein_id="YP_003108741.1"
FT   misc_feature    complement(102629..103450)
FT                   /note="prephenate dehydratase; Provisional; Region:
FT                   PRK11898"
FT                   /db_xref="CDD:171330"
FT                   /locus_tag="Afer_0097"
FT   misc_feature    complement(102911..103447)
FT                   /note="Prephenate dehydratase; Region: PDT; pfam00800"
FT                   /db_xref="CDD:144409"
FT                   /locus_tag="Afer_0097"
FT   misc_feature    complement(102641..102880)
FT                   /note="C-terminal ACT domain of the bifunctional chorismate
FT                   mutase-prephenate dehydratase (CM-PDT) enzyme and the
FT                   prephenate dehydratase (PDT) enzyme; Region: ACT_CM-PDT;
FT                   cd04905"
FT                   /db_xref="CDD:153177"
FT                   /locus_tag="Afer_0097"
FT   misc_feature    complement(order(102770..102781,102830..102841))
FT                   /note="putative L-Phe binding site; other site"
FT                   /db_xref="CDD:153177"
FT                   /locus_tag="Afer_0097"
FT   gene            103515..104228
FT                   /db_xref="GeneID:8322149"
FT                   /locus_tag="Afer_0098"
FT   CDS_pept        103515..104228
FT                   /locus_tag="Afer_0098"
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /codon_start="1"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-
FT                   carboxylate (AIR) carboxylase; KEGG: mrd:Mrad2831_1356
FT                   putative circadian phase modifier CpmA-like protein"
FT                   /db_xref="GI:256370918"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="GeneID:8322149"
FT                   /translation="MQPMSEDGLVRSDAGWFDTARRRRIGLPEAIYAPGKAETDLVALI
FT                   EQSLASGEPTIVTRVERELAERLVDRFDLRPYPALERRAPMVALAGNPVPSSSLERVGL
FT                   VGILAAGTSDRPVAAEAACVIETLGHRTRFVLDCGVAALARSVRAMEEVADADVVVVVA
FT                   GFEGALASVVGGSMAQPLIAVPTSTGYGAARGGETALWAMLATCAQGVCVVGVDNGFGA
FT                   GCAAVRIVGAAGRNA"
FT                   /protein_id="YP_003108742.1"
FT   misc_feature    103563..104204
FT                   /note="AIR carboxylase; Region: AIRC; cl00310"
FT                   /db_xref="CDD:153673"
FT                   /locus_tag="Afer_0098"
FT   gene            104225..105385
FT                   /db_xref="GeneID:8322150"
FT                   /locus_tag="Afer_0099"
FT   CDS_pept        104225..105385
FT                   /locus_tag="Afer_0099"
FT                   /gene_family="HOG000007120" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF111"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   mem:Memar_2158 hypothetical protein"
FT                   /db_xref="GI:256370919"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="GeneID:8322150"
FT                   /translation="MSRRTLVVNAAAGVAGDMLLAALLALGASREHVERALRPVGLDTA
FT                   LETSLVDRAGIRATQLVVGDDIEHTPLDEAGLRAACEAASLGPRGRELLSRALDLVLLG
FT                   ERTVHGGHGHALHELGSLDTVLDLVGTAAAFEALDVDGVLLGPVATGLGAAPMAHGVYP
FT                   IPAPAVAAIAAATGLVVEVRSGAEATTPTGAALLGALTMVRVAEASGAVAAVAYGAGTR
FT                   DDPDRANVLQALLLDGSDAVAEQIGVVETWLDDLSGEDLGRIADEAIGQGALDAWLLPG
FT                   LGKKGRPGFELRLVCAPSALESLVAWVHRRTQSPGVRHRLQERSVLSAWFDEVEVHGVS
FT                   CRIKVTPVGAKCEDDDARELAAVLGASVATARALALARWRESGVSR"
FT                   /protein_id="YP_003108743.1"
FT   misc_feature    104309..105310
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1641; cl03398"
FT                   /db_xref="CDD:174770"
FT                   /locus_tag="Afer_0099"
FT   misc_feature    104309..105310
FT                   /note="Protein of unknown function DUF111; Region: DUF111;
FT                   pfam01969"
FT                   /db_xref="CDD:145249"
FT                   /locus_tag="Afer_0099"
FT   gene            105406..106413
FT                   /db_xref="GeneID:8322151"
FT                   /locus_tag="Afer_0100"
FT   CDS_pept        105406..106413
FT                   /locus_tag="Afer_0100"
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /codon_start="1"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: acr:Acry_0942 alpha/beta hydrolase domain- containing
FT                   protein"
FT                   /db_xref="GI:256370920"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="GeneID:8322151"
FT                   /translation="MALDPTIASLLEQLAATGATTPVYELSLADARAGLDLVGTIGIAN
FT                   PPAVARVEQRTIDAGDHAIAAELVWGSEAPRAALLFVHGGGFVLGSLRGYGPMVRHLAA
FT                   STGALVVSLDYRLAPEHRFPAAVDDTLHGLRWLAAERDALGVSVLGVVGDSAGGNLAAV
FT                   ASIAAPSEGIDLALALELYPATDLSEDLASLERFGEGYYLTAEEARWFASQYLGDDERL
FT                   LADWRANPMAATDLDDLPLTIVATAGYDPIGDAGRRWAARLAALEPRGSVPDDLDERLR
FT                   QAGVEVSGWARGRVISLDFPTLVHGFASIAQLAPAAGAACELSYGLAAWVLERA"
FT                   /protein_id="YP_003108744.1"
FT   misc_feature    105694..106332
FT                   /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
FT                   pfam07859"
FT                   /db_xref="CDD:149109"
FT                   /locus_tag="Afer_0100"
FT   misc_feature    <105697..106167
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Afer_0100"
FT   gene            complement(106429..108747)
FT                   /db_xref="GeneID:8322152"
FT                   /locus_tag="Afer_0101"
FT   CDS_pept        complement(106429..108747)
FT                   /locus_tag="Afer_0101"
FT                   /gene_family="HOG000238647" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.31"
FT                   /transl_table="11"
FT                   /note="KEGG: afe:Lferr_1558 phosphoenolpyruvate
FT                   carboxylase"
FT                   /db_xref="GI:256370921"
FT                   /db_xref="InterPro:IPR001449"
FT                   /db_xref="GeneID:8322152"
FT                   /translation="MFNVLNVAEGADDVTDLAKLAPRSLGRIRLTPVLTAHPTETKRRT
FT                   ILHTLQRIAHAPNAVDPSDLRLLWFTEELRSRRLEVADEVHTGLFYLTTSLFDAIPVVY
FT                   RQLAAARGVDADAIGVPVRFGSWIGGDRDGNPLVTAEVTKAAFVANATACLEAFRSRLD
FT                   AVKRRLTHSMHFAAVSDAIVESIRNDEHDFVHLAPYVRTHYVDEPYRQKIYYLLARIDN
FT                   QLHRLHNDPEALDIAPLVGPDLETALRLIRDSLAAHGDTALAEGPLQDLVWQAATFGTH
FT                   LASLDIRQESTVHHQAILELFGDDPRLAGYWEADADDRLSMLLACLDHPPHARTPRTTL
FT                   VADLVALFDTLTTVEAELGPAAIGSYVISMTHHAADVIAVLVIARALGADHLDITPLFE
FT                   TIADLECLESVMEQLFTLPAYLAHLERRALRQEVMLGYSDSTKDGGMAASAYALYRAQE
FT                   ALIGLGERHAITVELFHGRGGTVGRGGGPIAQVARAHPRAALRGTIRITEQGETISHRY
FT                   ATTDRASATLLTALGAFGGADDDTAPTDRAVMVTELVARSSEHAYRALTTSAGFDAYFR
FT                   SVTPFPELTQLRIGSRPARRHQADTGLATIRAIPWVFAWAQSRHTLPAWFGIGTGLATA
FT                   REAHGDHAIREARASWPFVAGMLDNVQIALAKADMRLARRYLDLADDPTTAAAIFAVIE
FT                   EEYERTVAETLRATGQRRLLAWSPTLADSLTVRNRVLAELNPLQVTALGAWRSSRNPDD
FT                   LTLVLRSINAIATVQKNSG"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /protein_id="YP_003108745.1"
FT   misc_feature    complement(106432..108681)
FT                   /note="phosphoenolpyruvate carboxylase; Reviewed; Region:
FT                   PRK00009"
FT                   /db_xref="CDD:166715"
FT                   /locus_tag="Afer_0101"
FT   gene            complement(108980..109064)
FT                   /note="tRNA-Ser2"
FT                   /db_xref="GeneID:8322153"
FT                   /locus_tag="Afer_R0006"
FT   tRNA            complement(108980..109064)
FT                   /db_xref="GeneID:8322153"
FT                   /locus_tag="Afer_R0006"
FT                   /product="tRNA-Ser"
FT   gene            109147..109256
FT                   /db_xref="GeneID:8322154"
FT                   /locus_tag="Afer_R0007"