(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIFV_1

ID   ACIFV_1; SV 1; empty ; DNA; empty ; PRO; 2329769 BP.
XX
AC   NC_013740;
XX
PR   Project: 43471;
XX
DE   Acidaminococcus fermentans DSM 20731, complete genome.
XX
OS   Acidaminococcus fermentans DSM 20731
OC   Bacteria; Firmicutes; Negativicutes; Selenomonadales; Acidaminococcaceae;
OC   Acidaminococcus.
XX
RN   [1]
RP   1-2329769
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Saunders,E., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Pukall,R., Gehrich-Schroter,G., Schneider,S., Klenk,H.-P. and
RA   Eisen,J.A.;
RT   "The complete genome of Acidaminococcus fermentans DSM 20731";
RL   Unpublished
XX
RN   [2]
RP   1-2329769
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (15-JAN-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2329769
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Saunders,E., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Pukall,R., Gehrich-Schroter,G., Schneider,S., Klenk,H.-P. and
RA   Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (11-JAN-2010) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001859.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083224
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2329769
FT                   /strain="DSM 20731"
FT                   /mol_type="genomic DNA"
FT                   /organism="Acidaminococcus fermentans DSM 20731"
FT                   /db_xref="taxon:591001"
FT   gene            34..1194
FT                   /db_xref="GeneID:8738605"
FT                   /locus_tag="Acfer_0001"
FT   CDS_pept        34..1194
FT                   /locus_tag="Acfer_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: aac:Aaci_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:284047387"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:8738605"
FT                   /translation="MARKKMVELDLFAEQEPAAEPEKTAPAAPPEKKSPASLPQKPFVT
FT                   NLSPRYTFDNFVVGNSNRFAKAAAMAVANNPAFAYNPFFLFSDSGLGKTHLMNAIGNQI
FT                   RKNHPDMKILYISSETFTNELIESVEHNRLEAFREKYRSIDVLLIDDIQFLRNRESTQE
FT                   EFFHTFNTLEKANKQIIISSDRPPAELDTLEERMISRFNSGLTADIQHPDLETRMAILQ
FT                   NLAHTDKVPFPNDVILLIASSITSNIRELEGAYNRVCAYSTVSKEPITLELCRSALKEL
FT                   NLLDTPQFVTVDAIQQQVADHFRLHRAELIEKKRTRRVAVPRMIAIYLTKEMAGLSLKK
FT                   IGECFGGRDHSTIIHACEKIQKDRQEDPELNREIDALILELKNRTP"
FT                   /protein_id="YP_003397726.1"
FT   misc_feature    271..642
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    274..633
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    292..315
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    order(295..318,481..483,583..585)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    469..486
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    631..633
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    907..1176
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acfer_0001"
FT   misc_feature    order(976..978,1000..1005,1024..1026,1042..1050,1075..1089,
FT                   1096..1098,1105..1110)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acfer_0001"
FT   gene            1916..2539
FT                   /db_xref="GeneID:8736432"
FT                   /locus_tag="Acfer_0002"
FT   CDS_pept        1916..2539
FT                   /locus_tag="Acfer_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: CG3493 gene product from transcript CG3493-RA"
FT                   /db_xref="GI:284047388"
FT                   /db_xref="GeneID:8736432"
FT                   /translation="MITIKDYAKQKGVSYEAIRKQIKRYENELEGHLVKQNRFLMLDDE
FT                   AVQFLDSKRSENPVIVYEQNKDEELEQLRHENKVLLIQMNTVQDQLGKVQQKLIAEMNT
FT                   TKLLTQEKVHYLEYKAQSEQKEIQLKDLARARDAAQAKADQQEAVLRLKEQQIGALSAA
FT                   KETAAASLKAADERIAQAEARAKAAEEEASRLKNRSFWDRLFNR"
FT                   /protein_id="YP_003397727.1"
FT   gene            2751..4139
FT                   /db_xref="GeneID:8736433"
FT                   /locus_tag="Acfer_0003"
FT   CDS_pept        2751..4139
FT                   /locus_tag="Acfer_0003"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0867 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:284047389"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:8736433"
FT                   /translation="MMTKNLAQIWAEMLAALSASFEGRSWKIWLDAAHPRTLEENTLSL
FT                   DVPNDFTKNTLQEKYLPIMEESLSQICGKPMKVQIDVVETAKEGPSLFPDAPAQPAPEP
FT                   AAVQPEPQPAAKPAQEFDSHLSPKYTFDNFIRGKSNEEAFNFSMGVANAPAKSYNPLFL
FT                   YSDPGLGKTHLMNAIGNYIHKKFPQMKILYTSSETFTNELIGAIQHNTNEAFRNKYRNI
FT                   DVLLIDDIQFLRKKESTQEEFFHTFEALKQADKQIIISSDRPPKELDTLEERLTSRFMQ
FT                   GLIIEINHPDFETRSAILRSMAEKDHLEFPLEVIQLIATNVKTNIRELEGAYTKVHAFA
FT                   NLNHQPVTMELARKALKDLDMGSAVDKVITVEAIQELVASRYKIRVEDLKAKKRTRSIA
FT                   YPRQIAMYLTRELTDLSLPRIGECFGGRDHTTVLHACDKISEDKKNDANLERQLAKLVE
FT                   DLKK"
FT                   /protein_id="YP_003397728.1"
FT   misc_feature    2763..4136
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    2778..>2999
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    3207..3614
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    3243..3266
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    order(3246..3269,3432..3434,3534..3536)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    3420..3437
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    3582..3584
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    3861..4118
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acfer_0003"
FT   misc_feature    order(3930..3932,3954..3959,3978..3980,3996..4004,
FT                   4029..4043,4050..4052,4059..4064)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acfer_0003"
FT   gene            4387..5514
FT                   /db_xref="GeneID:8736434"
FT                   /locus_tag="Acfer_0004"
FT   CDS_pept        4387..5514
FT                   /locus_tag="Acfer_0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: tte:TTE0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:284047390"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8736434"
FT                   /translation="MQFSCESKELAQSVNIVKRAISSSNNAPIFSGIHAILQGNTLQLI
FT                   AMDNTYMMNKKLDVNGEEDGELLIPAKAIGDLLARFDPDEVLTVQQLPGEKEMTLKAAK
FT                   ARGQYHIPLMDPEEYPAMPLLQGDRTLQLPEEIMGKLISTTVYACSTDASRPLYTGVYL
FT                   EKSGQHLTAVGTNTHRLAIKEVELPEGDDSEFSMLIPARLLKEIGSNLNGELPEPVVLT
FT                   LKERQIMAQVGSLTIISSLIEGKFPDYKRPIPPSFSNRTVFNRVDMEKAIQRVSLFSQS
FT                   DYNIVRLAIDADGITLSSAVSDMGQGKEIIACQTVGDNLPLNIAFNSRYMTDFFKNCGT
FT                   DRVSLETNQSLSPARLMPEGDESYTYILTPVRVIF"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003397729.1"
FT   misc_feature    4387..5505
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Acfer_0004"
FT   misc_feature    4387..5502
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acfer_0004"
FT   misc_feature    order(4456..4458,4600..4602,4621..4623,4990..4992)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acfer_0004"
FT   misc_feature    order(4603..4605,4612..4614,4696..4698,4702..4704,
FT                   5215..5217,5308..5313)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acfer_0004"
FT   misc_feature    order(4909..4911,4915..4926,5365..5367,5491..5502)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acfer_0004"
FT   misc_feature    order(4909..4911,4915..4920,5140..5142,5245..5247,
FT                   5284..5289,5374..5376,5491..5502)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acfer_0004"
FT   gene            5514..6650
FT                   /db_xref="GeneID:8736435"
FT                   /locus_tag="Acfer_0005"
FT   CDS_pept        5514..6650
FT                   /locus_tag="Acfer_0005"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bbe:BBR47_00040 DNA
FT                   replication and repair protein F"
FT                   /db_xref="GI:284047391"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:8736435"
FT                   /translation="MRLENLRLLHFRNYEQVSIPLGHNITIFYGDNAQGKTNLLEGIHT
FT                   AARGFSFRTRHEEELPSFGAEEWAAELQYRDRYGSSRLLVKRYPVRGRMKKENLLNGNP
FT                   VTPREQYGLVNLVLFTPDDLQLVKGDPALRRKFLDMEIAQVSPVYYDLLAQYNRVLQQR
FT                   NRFLKQCRDREKLEEAQLLVWDGALAQLAAGILDHRLQALSGILQAARQVYDGITGTQE
FT                   ALTLSYVQKRGDGEETVRENPGPGAWEGFYREQLRLRHRLDYLRGYTSLGPHRDDLEIF
FT                   HEGRPLRAYGSQGQQRTAALALKLSELEFIRSVREEYPVLLLDDVLSELDQHRREKLLG
FT                   FINGTVQTFLTVNDRHLAPVDGDVAAYRVREGRLEETP"
FT                   /protein_id="YP_003397730.1"
FT   misc_feature    5520..>6017
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    5601..5624
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    order(5610..5615,5619..5627,5874..5876)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    5865..5876
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    <6285..6638
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    6384..6413
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    6471..6488
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    6495..6506
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   misc_feature    6561..6581
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0005"
FT   gene            6647..7378
FT                   /db_xref="GeneID:8736436"
FT                   /locus_tag="Acfer_0006"
FT   CDS_pept        6647..7378
FT                   /locus_tag="Acfer_0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF721"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   cef:CE0005 hypothetical protein"
FT                   /db_xref="GI:284047392"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="GeneID:8736436"
FT                   /translation="MKDSELLILKVMKTPRARQQFLLHWLKSHWAEILGHTAANHSQPY
FT                   RLEDGVLYVHTDNPMWSNQFHMMQGKLLGQLNRKLAPSLQGRKRIIRELKFYHGIIQEE
FT                   LRPRSEEGPFMLQRDDKRRCPVCGVPLIGTEEICSACRRKQQEALRREIRKQLDLRPWL
FT                   SYEDCRELVNCDRITFTDVKAVLEEWALNRALDPGSTAREKAFAVMLETGLRPEQLPEE
FT                   TIRQTLEKARRSRYYVPARRK"
FT                   /protein_id="YP_003397731.1"
FT   misc_feature    6665..6934
FT                   /note="Protein of unknown function (DUF721); Region:
FT                   DUF721; cl02324"
FT                   /db_xref="CDD:174721"
FT                   /locus_tag="Acfer_0006"
FT   gene            7356..7583
FT                   /db_xref="GeneID:8736437"
FT                   /locus_tag="Acfer_0007"
FT   CDS_pept        7356..7583
FT                   /locus_tag="Acfer_0007"
FT                   /gene_family="HOG000060930" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CHY_2706"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_2706 hypothetical protein"
FT                   /db_xref="GI:284047393"
FT                   /db_xref="GeneID:8736437"
FT                   /translation="MYLHVGNNYVVRCDEIIGIFDIRNKRTNIYRFFLKPRLGTDQVID
FT                   LTGDFPAASCVVTRDKIILSGISSRTLRKR"
FT                   /protein_id="YP_003397732.1"
FT   gene            7599..9539
FT                   /db_xref="GeneID:8736438"
FT                   /locus_tag="Acfer_0008"
FT   CDS_pept        7599..9539
FT                   /locus_tag="Acfer_0008"
FT                   /gene_family="HOG000075156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: tpd:Teth39_0010 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA gyrase
FT                   subunit B domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:284047394"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:8736438"
FT                   /translation="MAKKKQTIEEEIAVHGDYGAEQIQVLEGLEAVRKRPSMYIGSISG
FT                   RGLHHLVYEVIDNSIDEALAGYCDHIRVIIHPDNSITVTDNGRGIPVEMHKVGKPAIEV
FT                   VMTVLHAGGKFGDGGYKVSGGLHGVGVSCVNALSKKMVVEVKKNGKIYGIEFSKGKTTR
FT                   PLYVKGECPENETGTSVTFWPDDTIFTETVYSYDTLKHRIRELAFLNKGVKIQLTDERS
FT                   GQDEVFHYEGGIVSFVEFVNKGKEPLHAKPIYVEGERQDTIVEVAMQYTDAYTENIYTF
FT                   VNNINTEEGGTHLAGLKQALTRCINDYARKNSLLKDNEDNLSGDDVREGLTCVMSLKVR
FT                   EPQFEGQTKTKLGNSEVRGIVDNMVTEALTEYFEENAPVAKKIVEKAIMASRARSAARK
FT                   ARDLTRRKSALEVSSLPGKLADCSSKNAAETEIYLVEGDSAGGSAKQGRDRNFQAILPL
FT                   RGKILNVEKARLDKMLNSQEIRAMITAFGCGIGDEFDIAKARYGKIIIMTDADVDGAHI
FT                   RTLLLTFFYRYMKPLIQNGNVFIAQPPLYLIRTGKKHTYAYSDEELQRKLDEVGRQNNP
FT                   YVQRYKGLGEMNPEQLWETTMDPSKRTVLQVQLEDAATADSVFSVLMGDKVEPRRQFIE
FT                   ENAGKVTNLDF"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003397733.1"
FT   misc_feature    7650..9533
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    7740..8021
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(7758..7760,7770..7772,7779..7781,7845..7847,
FT                   7851..7853,7857..7859,7863..7868,7980..7991)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    7770..7772
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(7857..7859,7863..7865,7980..7982,7986..7988)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    8292..8762
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    8445..8447
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(8619..8621,8628..8633,8637..8639)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(8637..8639,8643..8645)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    8886..9227
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(8904..8909,8916..8918,9123..9125,9129..9131,
FT                   9135..9137)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    order(8904..8906,9123..9125)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Acfer_0008"
FT   misc_feature    9321..9503
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Acfer_0008"
FT   gene            9550..10245
FT                   /db_xref="GeneID:8736439"
FT                   /locus_tag="Acfer_0009"
FT   CDS_pept        9550..10245
FT                   /locus_tag="Acfer_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01378"
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphokinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: thiamine pyrophosphokinase; PFAM: Thiamin
FT                   pyrophosphokinase catalytic region; KEGG: dhd:Dhaf_3841
FT                   thiamine pyrophosphokinase"
FT                   /db_xref="GI:284047395"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="GeneID:8736439"
FT                   /translation="MTMEIQLPQGKLQWSRTGGPLLVVVAGGRRPDPQWLRRAAEGLPV
FT                   AAADRGADHCRAAGLVPGFLYGDRDSAAPGAWEEFARKGARVKTYPVNKDDTDLSLVLQ
FT                   DIPGNRTVLATGIWGGRADHLFGNLYTLLAYARRGGSAFMADDQEVLCYLLPGEGLRFT
FT                   SGKKRPRAVSLLPLTPSCRVSITGVRWPLDNAELTQANPYAVSNKMTEPALNAFCREGI
FT                   AGVYFTWKE"
FT                   /protein_id="YP_003397734.1"
FT   misc_feature    9616..10233
FT                   /note="Thiamine pyrophosphokinase; Region: TPK; cd07995"
FT                   /db_xref="CDD:153431"
FT                   /locus_tag="Acfer_0009"
FT   misc_feature    9622..10188
FT                   /note="thiamine pyrophosphokinase; Region: thi_PPkinase;
FT                   TIGR01378"
FT                   /db_xref="CDD:162328"
FT                   /locus_tag="Acfer_0009"
FT   misc_feature    order(9625..9633,9691..9699,9751..9753,9757..9762,
FT                   9829..9846,9898..9900,9904..9912,9919..9921,9931..9933,
FT                   10117..10119,10123..10125,10159..10170)
FT                   /note="active site"
FT                   /db_xref="CDD:153431"
FT                   /locus_tag="Acfer_0009"
FT   misc_feature    order(9697..9699,9709..9711,9718..9720,9829..9837,
FT                   9847..9849,9901..9903,9907..9930,9934..9939,9994..9996,
FT                   10000..10002,10060..10062,10066..10068,10072..10074,
FT                   10078..10083,10156..10158,10162..10167,10225..10227)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153431"
FT                   /locus_tag="Acfer_0009"
FT   misc_feature    order(9751..9753,9829..9840,10117..10119,10123..10125,
FT                   10159..10170)
FT                   /note="thiamine binding site; other site"
FT                   /db_xref="CDD:153431"
FT                   /locus_tag="Acfer_0009"
FT   gene            10251..11015
FT                   /db_xref="GeneID:8736440"
FT                   /locus_tag="Acfer_0010"
FT   CDS_pept        10251..11015
FT                   /locus_tag="Acfer_0010"
FT                   /gene_family="HOG000114881" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF81"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   bcg:BCG9842_B4966 hypothetical protein"
FT                   /db_xref="GI:284047396"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="GeneID:8736440"
FT                   /translation="MLEFHWQDLIFLLAAGFIGSFVDAAVGGGGLITLPAFMATGIPTP
FT                   FALGSNKLASSIGAVTSFFTFARSGKVDRKILKMMPLSFLGSAAGACIASLLPEHLLRY
FT                   IVVAALVGVALYTYHRKNWDGVNEMTEMTRSVVLGIAAMAWCLGMYDGFFGPGTGSFLI
FT                   FGFLYFGYNFVTAAGNTKALNLASNLGGLLAFLLLGRVYLAYALPMGLVEILGARLGAK
FT                   IAIKKGVGYIRTLYLVMTVLLIGKQVHDLFLK"
FT                   /protein_id="YP_003397735.1"
FT   misc_feature    10275..11000
FT                   /note="Predicted permeases [General function prediction
FT                   only]; Region: COG0730; cl00498"
FT                   /db_xref="CDD:176927"
FT                   /locus_tag="Acfer_0010"
FT   misc_feature    10284..10988
FT                   /note="Sulfite exporter TauE/SafE; Region: TauE; pfam01925"
FT                   /db_xref="CDD:145216"
FT                   /locus_tag="Acfer_0010"
FT   gene            11055..13550
FT                   /db_xref="GeneID:8736441"
FT                   /locus_tag="Acfer_0011"
FT   CDS_pept        11055..13550
FT                   /locus_tag="Acfer_0011"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_2704 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:284047397"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="GeneID:8736441"
FT                   /translation="MDDQQNDKQTISAGKVIPVYVEDEMQKCYIDYAMSVIVQRALPDV
FT                   RDGLKPVHRRILYAMNEAGMLPNKAYKKSARIVGDVLGKYHPHGDSSVYDAIVRLAQDF
FT                   STRYLMVDGHGNFGSVDGDPAAAMRYTEVRMGKIAVEMLRDIEKDTVDFIPNYDESLKE
FT                   PTVLPAKVPALLINGSAGIAVGMATNIPPHNLGEVVDACVMLIDHPDATVEQLMTAVKG
FT                   PDFPTGAKILGLSGIRQAYTTGRGVVKVRAKTHVEPMPKNKNRIVVTEIPYQVNKAKLI
FT                   ENIAHLVQDKTLEGITDLRDESDRKGMRIVIELRSDVVPEIMLNKLYKHTQLQDSFGII
FT                   MLALVNGHPRILNLKQILEYYLDHQKDVITRKCRYELKKAKERAHILEGLKIALDHLDE
FT                   VIATIRASANGEVAKAALMEKFGLSDRQAQAILDMRLQRLTGLERQKIEDEYKEVMATI
FT                   AYLEDVLSDEHKIMGIAREDLLDVKKRFGDARRTSIVPDTGDLETEDLIAEEDVVITIS
FT                   HQSYIKRQALTNFRNQNRGGRGIKAGSGKIVKEDNKVKGDFSEHLLMASTHDNILFFTN
FT                   RGRVYRQKGFEIPEASRTAKGTFIRNLLPLEENEKVNAVIAVKSGISEDEKKFLFMATN
FT                   LGYVKRTSVSEFKSARKGGLIAINLGEGEELIDVKLTSGHNDILLATRDGYAIHFLEDD
FT                   VRPMGRTSHGVRGISLRPHDSVVSMDSCVDDTGEVLTVTDKGQGKRTDISEYRVQTRGG
FT                   KGIINLKVTDRTGLIVGSKFINETHDIMLISAAGIIIRMNAADISTYGRNAQGVKLMDL
FT                   EAGDKVAALAIVNTVSEDE"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003397736.1"
FT   misc_feature    11067..13547
FT                   /note="DNA gyrase subunit A; Validated; Region: PRK05560"
FT                   /db_xref="CDD:168095"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    11166..12500
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    order(11166..11249,11262..11411,11415..11471,11475..11546,
FT                   11553..11555)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    11442..11444
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    order(12237..12245,12252..12263,12294..12299,12339..12389)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    12582..12722
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    12756..12914
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    12936..13076
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    13077..>13190
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    13236..>13346
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   misc_feature    13383..13532
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Acfer_0011"
FT   gene            13834..14274
FT                   /db_xref="GeneID:8736442"
FT                   /locus_tag="Acfer_0012"
FT   CDS_pept        13834..14274
FT                   /locus_tag="Acfer_0012"
FT                   /gene_family="HOG000159791" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bwe:BcerKBAB4_0693 hypothetical protein"
FT                   /db_xref="GI:284047398"
FT                   /db_xref="GeneID:8736442"
FT                   /translation="MAELNQKAESFKRFVEKKDPKAFVVDPIKDDPFHTVVFRSHLDVE
FT                   GTPLQLIVVLDDSAFGVIRVLLAPKALKEGNKEALLEMLNRYNSNYKAFKFYLDKEESL
FT                   IMDTCVIFRESQVDGNMMYGLFQMISRELDEKYKDIMKTIWE"
FT                   /protein_id="YP_003397737.1"
FT   gene            complement(14311..15189)
FT                   /db_xref="GeneID:8736443"
FT                   /locus_tag="Acfer_0013"
FT   CDS_pept        complement(14311..15189)
FT                   /locus_tag="Acfer_0013"
FT                   /gene_family="HOG000159792" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bpu:BPUM_3485 transcriptional regulator"
FT                   /db_xref="GI:284047399"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736443"
FT                   /translation="MKLTQIEYFITVCECGSFSRAAEKCHISQPGISKAIRELEEECGV
FT                   ALFQRNRNNIQITRRGRILLEHARQFQNHYRNLCQVVRTLGTGKALIRIGIATMRGNTI
FT                   FPQIHGAFLKSHPQITIETVEETTKVLYELLDRQEIDFALCVTNRLPEEPNHCLLLRKS
FT                   YLKLFVRQDHPLARRETVDLTELRNIPLVLFSDHFDQTAYIRHMFAQSGVHPWILHQTT
FT                   QVFTILEYIRSEGAAGFLTEEIAQQEPDLHAVSVRQFRPAYITLDWNKDLHFNPAMEEF
FT                   VRFVKKGLPSA"
FT                   /protein_id="YP_003397738.1"
FT   misc_feature    complement(14317..15189)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0013"
FT   misc_feature    complement(<15043..15183)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0013"
FT   misc_feature    complement(14335..14916)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0013"
FT   misc_feature    complement(order(14491..14496,14500..14505,14521..14538,
FT                   14815..14835,14839..14841,14851..14853,14860..14865,
FT                   14869..14874))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0013"
FT   gene            15401..17044
FT                   /db_xref="GeneID:8736444"
FT                   /locus_tag="Acfer_0014"
FT   CDS_pept        15401..17044
FT                   /locus_tag="Acfer_0014"
FT                   /gene_family="HOG000042487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.38"
FT                   /transl_table="11"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: apv:Apar_1191 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /db_xref="GI:284047400"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736444"
FT                   /translation="MTTSKRGYDLLNDPFLNKGTAFTREERKKYGLIGILPPQVETIEL
FT                   QDQQAFENFCERPNKAVQRHYLMKLFSRNRTLFFHLFSHHLEKLMPVLYAPGVAESVKQ
FT                   YSELFTTPQNAVYLSIDNMDDIEESLKNGASGRDIQLIVVTDGESILGIGDWGTNGVSI
FT                   STGKILVYTAAAGIDPAKVLPVVLDAGTNRQSLIDDPLYLGLHHERISDGRYDAFVDAF
FT                   LQTAEKLFPHLYVHFEDFGRENAARLLERYEDRYAVYNDDIEGTGAVTLAAILGGLKAS
FT                   GEKLTDQTFLCFGAGTSGMGIVRQVFEEMKLQGLSDEEARSRFYLVDQQGLLFEDTEGM
FT                   TPQQKPYARKRSEFPAGASLDNLEDVVKAIHPTILVGASTAAGAFTREIVQEMAAHTPR
FT                   PIIFPLSNPADLAEASADDLLHWTDGKALVATGTASRKVVYHGTIFEIGQANNSLVFPG
FT                   MGLAVAACRARKVSPGMLAAAAHALADLVDMEKPGASVLPPVREMGNFTKILAEKVVRQ
FT                   AVQEGLNGIPVEDPKEAIEAIQWKAEYKEL"
FT                   /product="Malate dehydrogenase (oxaloacetate-
FT                   decarboxylating)"
FT                   /protein_id="YP_003397739.1"
FT   misc_feature    15401..17041
FT                   /note="malate dehydrogenase; Provisional; Region: PRK13529"
FT                   /db_xref="CDD:172111"
FT                   /locus_tag="Acfer_0014"
FT   misc_feature    15617..16156
FT                   /note="Malic enzyme, N-terminal domain; Region: malic;
FT                   pfam00390"
FT                   /db_xref="CDD:144108"
FT                   /locus_tag="Acfer_0014"
FT   misc_feature    16187..17020
FT                   /note="NAD(P) binding domain of malic enzyme (ME), subgroup
FT                   1; Region: NAD_bind_1_malic_enz; cd05312"
FT                   /db_xref="CDD:133454"
FT                   /locus_tag="Acfer_0014"
FT   misc_feature    order(16283..16294,16382..16387,16535..16540,16613..16621,
FT                   16694..16696,16748..16750,16754..16756)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133454"
FT                   /locus_tag="Acfer_0014"
FT   gene            17411..18589
FT                   /db_xref="GeneID:8736445"
FT                   /locus_tag="Acfer_0015"
FT   CDS_pept        17411..18589
FT                   /locus_tag="Acfer_0015"
FT                   /gene_family="HOG000130990" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   gtn:GTNG_2930 branched chain amino acid ABC transporter
FT                   amino acid-binding protein"
FT                   /db_xref="GI:284047401"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:8736445"
FT                   /translation="MKAWKKAVGALAMTTLVASMFTGCGKKDAAKKDNGNEIRVGALFE
FT                   LTGNVANYGKSTYKGVQLAVDQINAKGGINGKKIKLVEADNKSEPSESGNAATKLITKD
FT                   KVSVIIGPATSGCVSAATPVVTNSKVPLMAPVATAPGITVDEKGKVRPFIFRACFTDPF
FT                   QGKLMAKFAVDTLKLKNIAIFYDSSSDYSKGLMDVFGKTLEEKGGKVVGKEAFLAKDQD
FT                   FKSALTKLKATNPEALYVPGYYEEVSKIIKQAREVGLTCPILGSDGWDSPKLAQIAGGE
FT                   ALNGTYFTSAYSAQDKDPHVQQFIKDYKAKFNEEPDTFAIHAYDGTLAVAEAIKQAGTT
FT                   DGTKIADALSKIKDLQVATGKYTLDKDHNPVSGGIIIEMKDGVQTFKEKITL"
FT                   /protein_id="YP_003397740.1"
FT   misc_feature    17513..18571
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component [Amino acid transport and
FT                   metabolism]; Region: LivK; COG0683"
FT                   /db_xref="CDD:31027"
FT                   /locus_tag="Acfer_0015"
FT   misc_feature    17525..18544
FT                   /note="Type I periplasmic ligand-binding domain of
FT                   uncharacterized ABC (Atpase Binding Cassette)-type active
FT                   transport systems that are predicted to be involved in
FT                   uptake of amino acids, peptides, or inorganic ions; Region:
FT                   PBP1_ABC_ligand_binding_like_12; cd06347"
FT                   /db_xref="CDD:107342"
FT                   /locus_tag="Acfer_0015"
FT   misc_feature    order(17747..17755,17816..17824,17981..17983,18137..18139,
FT                   18209..18211)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107342"
FT                   /locus_tag="Acfer_0015"
FT   gene            18661..19557
FT                   /db_xref="GeneID:8736446"
FT                   /locus_tag="Acfer_0016"
FT   CDS_pept        18661..19557
FT                   /locus_tag="Acfer_0016"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   drm:Dred_2239 inner-membrane translocator"
FT                   /db_xref="GI:284047402"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8736446"
FT                   /translation="MDTGSFAHQFIQQIVNGVSLGSIYALIALGYTMIYGIIKLINFAH
FT                   GDIYMLGAYIGFVAITKAGLPFLPALIVSMIGAALAGIIIERIAYKPMRNAPRIAALIT
FT                   AIGVSFFLENGMILLVSPQPRTFPPVFAPTVYHIGGIVVNNQQIMILVSALLLMLALTY
FT                   IVNRTKAGKAMRAVSFDADAAKLMGIDTDRVISTTFALGSALAAAAGVLVGIYYNSIDP
FT                   LMGMMPGIKAFIAAVVGGIGILPGAMLGGIIMGLVEAMVSGFFSSTYRDAAAFAILILI
FT                   LLYKPTGLLGKNVKEKV"
FT                   /protein_id="YP_003397741.1"
FT   misc_feature    18709..19530
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivH
FT                   and related proteins. LivH is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivH_like;
FT                   cd06582"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Acfer_0016"
FT   misc_feature    19204..19260
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119324"
FT                   /locus_tag="Acfer_0016"
FT   gene            19567..20547
FT                   /db_xref="GeneID:8736447"
FT                   /locus_tag="Acfer_0017"
FT   CDS_pept        19567..20547
FT                   /locus_tag="Acfer_0017"
FT                   /gene_family="HOG000202417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   hmo:HM1_0492 branched-chain amino acid abc transporter,
FT                   permease protein"
FT                   /db_xref="GI:284047403"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:8736447"
FT                   /translation="MKSLRQSLHKQDLLGLGIMVILFVVFYFLFDEEILDDYWETNVIL
FT                   ILINIIMAVSLNLINGLTGQFSIGHAGFMAVGAYTSAIITVKLGMDFPIALIVATVSAA
FT                   FLGFLIGMPTLRLNGDYLAIATLGLGEIIRIAILNIDYVGGASGFMGIPRLTTFPIAFW
FT                   IMVFVVYFIKNFKNSADGRACLAIRENEIAAETMGINTTKYKVMAFTIGAGFAGTAGAL
FT                   FSHYYYIAHPASFTFMRSFDVLTMVVLGGLGSISGSISGAVLLTAISAALADYPEWRMV
FT                   IYSIVLIVLMLNRPQGIFGNKELSLKMFQSIKLGGGSRGGTAQSE"
FT                   /protein_id="YP_003397742.1"
FT   misc_feature    19702..20466
FT                   /note="Transmembrane subunit (TM) of Escherichia coli LivM
FT                   and related proteins. LivM is one of two TMs of the E. coli
FT                   LIV-1/LS transporter, a Periplasmic Binding Protein
FT                   (PBP)-dependent ATP-Binding Cassette (ABC) transporter
FT                   involved in the uptake of...; Region: TM_PBP1_LivM_like;
FT                   cd06581"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Acfer_0017"
FT   misc_feature    20140..20196
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119323"
FT                   /locus_tag="Acfer_0017"
FT   gene            20522..21292
FT                   /db_xref="GeneID:8736448"
FT                   /locus_tag="Acfer_0018"
FT   CDS_pept        20522..21292
FT                   /locus_tag="Acfer_0018"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: drm:Dred_2237 ABC transporter related"
FT                   /db_xref="GI:284047404"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8736448"
FT                   /translation="MAELLKVNNASMIFGGLRAVSNLTMQIDEGELIGLIGPNGAGKTT
FT                   AFNMLTGVYEPSEGEITFNGQRINGKKPYQVTQMGIARTFQNIRLFSELSVLDNVKIAF
FT                   NNQIRYGLAEAIGRFGRYFKEEESIEEKALALLKIFHLEKLRDEMAKNLPYGEQRRLEI
FT                   ARALATSPKLLLLDEPAAGMNPQETKELMEMIRWIKKEFNLSILLIEHDMGLVMNVCQR
FT                   IYVLEYGICIANGTPDEIKHNKRVIKAYLGEEVS"
FT                   /protein_id="YP_003397743.1"
FT   misc_feature    20522..21280
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivG; COG0411"
FT                   /db_xref="CDD:30760"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    20534..21259
FT                   /note="The Mj1267/LivG ABC transporter subfamily is
FT                   involved in the transport of the hydrophobic amino acids
FT                   leucine, isoleucine and valine.  MJ1267 is a branched-chain
FT                   amino acid transporter with 29% similarity to both the LivF
FT                   and LivG components of the E...; Region:
FT                   ABC_Mj1267_LivG_branched; cd03219"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    20630..20653
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    order(20639..20644,20648..20656,20777..20779,21050..21055,
FT                   21152..21154)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    20768..20779
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    20978..21007
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    21038..21055
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    21062..21073
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   misc_feature    21140..21160
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72978"
FT                   /locus_tag="Acfer_0018"
FT   gene            21292..21996
FT                   /db_xref="GeneID:8736449"
FT                   /locus_tag="Acfer_0019"
FT   CDS_pept        21292..21996
FT                   /locus_tag="Acfer_0019"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hmo:HM1_0494 branched-chain amino acid abc
FT                   transporter, ATP-binding protein"
FT                   /db_xref="GI:284047405"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736449"
FT                   /translation="MLTIKNLNVYYGAIHAVKDLNMEVGDGEIVTLIGSNGAGKSTTLH
FT                   TISGLIKPKTGSILYKGEEIVGVPAHKLVGRGLVQVPEGRHVFAEMTVMENLDMGAYLR
FT                   TDKDGIARDKEKVFEKFPRLKERISQTAGTLSGGEQQMLAMGRALMSRPQLLILDEPSM
FT                   GLAPLLVREIFSIIKEINSEGTTVLLVEQNANMALSIADRAYVLETGRVVLSGTAAELA
FT                   ASEAVQKAYLGG"
FT                   /protein_id="YP_003397744.1"
FT   misc_feature    21292..21993
FT                   /note="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component [Amino acid transport and
FT                   metabolism]; Region: LivF; COG0410"
FT                   /db_xref="CDD:30759"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21295..21960
FT                   /note="LivF (TM1139) is part of the LIV-I bacterial
FT                   ABC-type two-component transport system that imports
FT                   neutral, branched-chain amino acids.  The  E. coli
FT                   branched-chain amino acid transporter comprises a
FT                   heterodimer of ABC transporters (LivF and LivG), a...;
FT                   Region: ABC_TM1139_LivF_branched; cd03224"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21391..21414
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    order(21400..21405,21409..21417,21538..21540,21766..21771,
FT                   21865..21867)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21529..21540
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21694..21723
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21754..21771
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21778..21789
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   misc_feature    21853..21873
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72983"
FT                   /locus_tag="Acfer_0019"
FT   gene            22012..22680
FT                   /db_xref="GeneID:8736450"
FT                   /locus_tag="Acfer_0020"
FT   CDS_pept        22012..22680
FT                   /locus_tag="Acfer_0020"
FT                   /gene_family="HOG000187908" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="CBS domain containing membrane protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; amino acid-
FT                   binding ACT domain protein; SMART: CBS domain containing
FT                   protein; KEGG: smu:SMU.1664c putative acetoin utilization
FT                   protein, acetoin dehydrogenase"
FT                   /db_xref="GI:284047406"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736450"
FT                   /translation="MQVKDLMTKVVKVVTTEQSLLEIRELMLNNNLRRIPVVDGDGHLK
FT                   GIVTDGDVSRATPSDASTLDRYEANYILGKLKAKDLMTKAVITVKAEDGVETAAYLMYK
FT                   FKIGALPVVDATNKVVGIISDTDVFKAFVDLLGYAKTSTKITVDTQDKVGVLAELAEIF
FT                   KNRGVNIISVVTRKIGPKRAAITVRADLTNAMDIIQTIRDAGFVITDISTLKVDDAHEE
FT                   "
FT                   /protein_id="YP_003397745.1"
FT   misc_feature    22018..22398
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="Acfer_0020"
FT   misc_feature    22048..22404
FT                   /note="This cd contains two tandem repeats of the
FT                   cystathionine beta-synthase (CBS pair) domains in  the
FT                   acetoin utilization proteins in bacteria. Acetoin is a
FT                   product of fermentative metabolism in many prokaryotic and
FT                   eukaryotic microorganisms.  They produce...; Region:
FT                   CBS_pair_ACT_assoc2; cd04585"
FT                   /db_xref="CDD:73085"
FT                   /locus_tag="Acfer_0020"
FT   misc_feature    22435..22635
FT                   /note="ACT domains are commonly involved in specifically
FT                   binding an amino acid or other small ligand leading to
FT                   regulation of the enzyme; Region: ACT; cl09141"
FT                   /db_xref="CDD:175018"
FT                   /locus_tag="Acfer_0020"
FT   gene            22670..22870
FT                   /db_xref="GeneID:8736451"
FT                   /locus_tag="Acfer_0021"
FT   CDS_pept        22670..22870
FT                   /locus_tag="Acfer_0021"
FT                   /gene_family="HOG000087963" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06107"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF951"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF951; KEGG:
FT                   cpy:Cphy_3775 hypothetical protein"
FT                   /db_xref="GI:284047407"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="GeneID:8736451"
FT                   /translation="MKNEADYKVGDIVRMKKAHPCGSYEWDVLRVGMDFGIKCRGCGHY
FT                   VLLPRAKFEKAVREVLVHKED"
FT                   /protein_id="YP_003397746.1"
FT   misc_feature    22685..22855
FT                   /note="Bacterial protein of unknown function (DUF951);
FT                   Region: DUF951; cl01864"
FT                   /db_xref="CDD:154632"
FT                   /locus_tag="Acfer_0021"
FT   gene            22959..23687
FT                   /db_xref="GeneID:8736452"
FT                   /locus_tag="Acfer_0022"
FT   CDS_pept        22959..23687
FT                   /locus_tag="Acfer_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047408"
FT                   /db_xref="GeneID:8736452"
FT                   /translation="MKKWLGACVLGVCLTVLPMPALAVHWMSLGSSEEGEILMDRDSLK
FT                   RPADTSLTVWEKVLWPQSDAHGRTGELRHREYDMKGKKWRQLSSYQLDARGRKTAGNRK
FT                   IQEWQEFQPMTSLFTRARYEWDYSRWRGPWVFIKSLPGLGRKWFNPDSLEKKGPNTYQV
FT                   WEKTVMKKPVNGTRILVSQTRYDVKNGKARTLYLCTFDDRNNMTDHYAVNDVWNKKGDT
FT                   YGEYIGDQLASYYARHPRKK"
FT                   /protein_id="YP_003397747.1"
FT   gene            23699..24358
FT                   /db_xref="GeneID:8736453"
FT                   /locus_tag="Acfer_0023"
FT   CDS_pept        23699..24358
FT                   /locus_tag="Acfer_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05656"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF805"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   ppr:PBPRA1415 hypothetical protein"
FT                   /db_xref="GI:284047409"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="GeneID:8736453"
FT                   /translation="MKTCPKCHKIYEDSQNFCSEDGTPLVLTPVSQTLRGETEAPNPPV
FT                   PAAQPETEQQGQPDSGQGTGTREQQNWQQQSQNGWQQQGQQQQQYQYGPNGNPSFSARF
FT                   QANIPDGNTWKPMYFSFNGRLNRGTYICRWLVLLLAAVLIGLICGILPFLAPLGYLALL
FT                   GLFVAQISLAVRRLHDRGHSGFWMFVCVVPALNLLMFLYLLFAESQPGQNEYGVAE"
FT                   /protein_id="YP_003397748.1"
FT   misc_feature    24050..24346
FT                   /note="Protein of unknown function (DUF805); Region:
FT                   DUF805; cl01224"
FT                   /db_xref="CDD:154274"
FT                   /locus_tag="Acfer_0023"
FT   gene            24684..26228
FT                   /db_xref="GeneID:8736454"
FT                   /locus_tag="Acfer_R0001"
FT   rRNA            24684..26228
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736454"
FT                   /locus_tag="Acfer_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            26605..29507
FT                   /db_xref="GeneID:8736455"
FT                   /locus_tag="Acfer_R0002"
FT   rRNA            26605..29507
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736455"
FT                   /locus_tag="Acfer_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            29738..29853
FT                   /db_xref="GeneID:8736456"
FT                   /locus_tag="Acfer_R0003"
FT   rRNA            29738..29853
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736456"
FT                   /locus_tag="Acfer_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            30139..30339
FT                   /db_xref="GeneID:8736457"
FT                   /locus_tag="Acfer_0024"
FT   CDS_pept        30139..30339
FT                   /locus_tag="Acfer_0024"
FT                   /gene_family="HOG000265452" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ACP_1735"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aca:ACP_1735 hypothetical protein"
FT                   /db_xref="GI:284047410"
FT                   /db_xref="GeneID:8736457"
FT                   /translation="MGRMLIGLGLLLVVTGLVVELGAHFFPLGHLPGDIHITGKHGSFY
FT                   FPVVTCIVVSVVLNLLLRLFH"
FT                   /protein_id="YP_003397749.1"
FT   misc_feature    <30211..30294
FT                   /note="Protein of unknown function (DUF2905); Region:
FT                   DUF2905; pfam11146"
FT                   /db_xref="CDD:151590"
FT                   /locus_tag="Acfer_0024"
FT   gene            complement(30375..30941)
FT                   /db_xref="GeneID:8736458"
FT                   /locus_tag="Acfer_0025"
FT   CDS_pept        complement(30375..30941)
FT                   /locus_tag="Acfer_0025"
FT                   /gene_family="HOG000216982" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: ctc:CTC01203 HAD superfamily hydrolase"
FT                   /db_xref="GI:284047411"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:8736458"
FT                   /translation="MSPETFLAILTRAGRLKTATRHCWTASGRQESVADHSWRMALMAL
FT                   LLSKEPEFRELDLDRVIRMCLIHDLGEAFTGDIPTFAKGDRNRAVEQDCWASWLATFPE
FT                   ENREEWQALLEEMEAQETREARLYKALDKLEAVISHNESDRDTWLPLEYDLQFTYPEKA
FT                   VQFSPWLKELKKAVDQWTEAKIKNR"
FT                   /protein_id="YP_003397750.1"
FT   misc_feature    complement(<30507..30926)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Acfer_0025"
FT   gene            complement(31157..31669)
FT                   /db_xref="GeneID:8736459"
FT                   /locus_tag="Acfer_0026"
FT   CDS_pept        complement(31157..31669)
FT                   /locus_tag="Acfer_0026"
FT                   /gene_family="HOG000223382" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /codon_start="1"
FT                   /product="Ferritin Dps family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   dhd:Dhaf_2260 ferritin Dps family protein"
FT                   /db_xref="GI:284047412"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="GeneID:8736459"
FT                   /translation="MLDNKVRDLINEQVTKEFYSAYLYLDFANYYQEKGLDGFAHWFDI
FT                   QAQEERDHAMLMRTYLQNNDVPVVFGTIDKPDMTCKKLDDALKAALKHEQFITGCINKI
FT                   YAAADKAKDYRTMQFFDWFVKEQGEEEKNVSDLIKKFELFGSDPKGLYALNQELLARVY
FT                   AAPTLVP"
FT                   /protein_id="YP_003397751.1"
FT   misc_feature    complement(31196..31663)
FT                   /note="nonheme-containing ferritins; Region:
FT                   Nonheme_Ferritin; cd01055"
FT                   /db_xref="CDD:153113"
FT                   /locus_tag="Acfer_0026"
FT   misc_feature    complement(31238..31648)
FT                   /note="Ferritin-like domain; Region: Ferritin; pfam00210"
FT                   /db_xref="CDD:143967"
FT                   /locus_tag="Acfer_0026"
FT   misc_feature    complement(order(31280..31285,31292..31294,31388..31390,
FT                   31511..31513,31520..31525,31619..31621))
FT                   /note="ferroxidase diiron center; other site"
FT                   /db_xref="CDD:153113"
FT                   /locus_tag="Acfer_0026"
FT   gene            31791..32318
FT                   /db_xref="GeneID:8736460"
FT                   /locus_tag="Acfer_0027"
FT   CDS_pept        31791..32318
FT                   /locus_tag="Acfer_0027"
FT                   /gene_family="HOG000060820" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: lrl:LC705_00607
FT                   hydrolase, NUDIX family"
FT                   /db_xref="GI:284047413"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="GeneID:8736460"
FT                   /translation="MHFEYCPTCGSHLQSKPAGDEGPVPFCPVCQRYWFDFFYSCIIIL
FT                   LCNEQDEVVLCKQPHLSQEYESITSGFIMPGETAEETAHREVREELGLTLERMIPEGTY
FT                   WFSKGQMLMHGFLGFVRKQPFRLSQEVTSAHWVPILDLPQTAYPETPENVIYPLWRKLL
FT                   AMKGLEEPKKRK"
FT                   /protein_id="YP_003397752.1"
FT   misc_feature    31911..32222
FT                   /note="Nudix hydrolase is a superfamily of enzymes found in
FT                   all three kingdoms of life, and it catalyzes the hydrolysis
FT                   of NUcleoside DIphosphates linked to other moieties, X.
FT                   Enzymes belonging to this superfamily require a divalent
FT                   cation, such as Mg2+ or...; Region: Nudix_Hydrolase;
FT                   cl00447"
FT                   /db_xref="CDD:176581"
FT                   /locus_tag="Acfer_0027"
FT   misc_feature    order(32001..32009,32037..32063)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72880"
FT                   /locus_tag="Acfer_0027"
FT   gene            32507..34051
FT                   /db_xref="GeneID:8736461"
FT                   /locus_tag="Acfer_0028"
FT   CDS_pept        32507..34051
FT                   /locus_tag="Acfer_0028"
FT                   /gene_family="HOG000285565" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /codon_start="1"
FT                   /product="AbgT putative transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: AbgT putative transporter; KEGG: cdf:CD2835
FT                   putative aminobenzoyl-glutamate transport protein"
FT                   /db_xref="GI:284047414"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="GeneID:8736461"
FT                   /translation="MTAGTQEKTKKSLMDRFLNAVEVAGNKLPDPATLFIILAVIVIIL
FT                   SAIFGSMGVSAVHPGTGKEIKVVNLLTVDGFRMMWSKAVTNFSTFAPLGMVLVCVLGAG
FT                   VAEKSGFLAAFMQKMLGDAAPALVTWVIIFIGINGNVAGDAAFVVLPPVAGVIYLSMGR
FT                   HPLLGVFTAFASVAAGFCANVMLGMSDSLAYGFTEAAAKLIDPSYQQTPAINYYFLVVS
FT                   CFLLSFVGTFVTEKIMAPRFAGVDLSKYEIDKSLTEMTPRNKAAVNKAIVATLITLVVI
FT                   ALLCVGADPILGDPKTHSIMNVKSPFMTGIILMVTLVLFVPGAVYGFASGKYKNDKDMF
FT                   ADISQAFKDISSYILLCFFCSQFTSYFGWSKLGLVLAIKGAAGLKAMNFTGLPLIIGLV
FT                   IVSCIVNIFIGSASAKWAILAPVMVPMMMLMGFDPALTQVAYRIGDSLTNPLSPLFYYF
FT                   PLMLGFARKYEKDTGMGTIIANMLPYSICFAIAWLILLAAWVVLDLPLGPGGGIYL"
FT                   /protein_id="YP_003397753.1"
FT   misc_feature    32552..33970
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0028"
FT   misc_feature    32552..33970
FT                   /note="p-Aminobenzoyl-glutamate transporter family; Region:
FT                   ydaH; TIGR00819"
FT                   /db_xref="CDD:129899"
FT                   /locus_tag="Acfer_0028"
FT   gene            34271..34585
FT                   /db_xref="GeneID:8736462"
FT                   /locus_tag="Acfer_0029"
FT                   /pseudo
FT   gene            34615..35790
FT                   /db_xref="GeneID:8736463"
FT                   /locus_tag="Acfer_0030"
FT   CDS_pept        34615..35790
FT                   /locus_tag="Acfer_0030"
FT                   /gene_family="HOG000241404" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.14"
FT                   /transl_table="11"
FT                   /note="KEGG: cdf:CD1086 putative peptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="GI:284047415"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:8736463"
FT                   /translation="MDVKALAADEKAYILEQRHWLHAHPELGREEKNTTAHIAAELERM
FT                   GIPVQTFPDITGCIGTIQGTKGPGKTLMLRADIDALPIQEADLTKTYASQNPGVMHACG
FT                   HDCHTAMLLGAAKILSAHRDAFPGKVKLLFQMGEEIGTESRHYVEKGCLDDVDAIFGMH
FT                   IWALLDAGTANLEDRERMACSDRFTLTLTGKTALSDAPEQGADPLAAAASVVMGLQQLV
FT                   SRQNDPENTFVLTVGMMNSEGNKGELARSVQLVGTTRTFNKAFRKTLPEKIEKVARAFG
FT                   EGLGCQVDCTYFFGPAPLINEHRNLNDCGRKAVARIMGDKALVPMEKQMGAEDFSVFME
FT                   KVPGVFLFLGARNKEKGICCVHHHPGFEVDEDVLPNGTGIEVQFALEYLNG"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_003397754.1"
FT   misc_feature    34615..35784
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Acfer_0030"
FT   misc_feature    34639..35784
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0030"
FT   gene            35919..36713
FT                   /db_xref="GeneID:8736464"
FT                   /locus_tag="Acfer_0031"
FT   CDS_pept        35919..36713
FT                   /locus_tag="Acfer_0031"
FT                   /gene_family="HOG000262396" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /codon_start="1"
FT                   /EC_number="5.1.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: hmo:HM1_0460 glutamate racemase, putative;
FT                   TIGRFAM: glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase"
FT                   /db_xref="GI:284047416"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="GeneID:8736464"
FT                   /translation="MNRLDPIGVIDSGVGGLTVLKWLQEKMPHERFIFIGDTARTPYGN
FT                   RSREEIQGFVGEMTAWLNRRNIKQLVVACNTITVLGTDVIKNGYDFSVIGMKKGAHMVE
FT                   GVTRNKKVGFLATDFTVASGAHKKEIQEMDPEIQVFGQGCPKFVPLIEGEQFGSPELAA
FT                   AIKEYTDKLKEYDVDTVMLSCTHYPFVEKEIREAFGPGVTILDPAERTVQAAMEDLKQR
FT                   RLNRETGLGRAEVCFTADLERGKRLAARMLDMNQCDFRLIHL"
FT                   /product="glutamate racemase"
FT                   /protein_id="YP_003397755.1"
FT   misc_feature    35934..36674
FT                   /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
FT                   cl00518"
FT                   /db_xref="CDD:174258"
FT                   /locus_tag="Acfer_0031"
FT   gene            36819..36894
FT                   /note="tRNA-Thr1"
FT                   /db_xref="GeneID:8736465"
FT                   /locus_tag="Acfer_R0004"
FT   tRNA            36819..36894
FT                   /db_xref="GeneID:8736465"
FT                   /locus_tag="Acfer_R0004"
FT                   /product="tRNA-Thr"
FT   gene            37000..37914
FT                   /db_xref="GeneID:8736466"
FT                   /locus_tag="Acfer_0032"
FT   CDS_pept        37000..37914
FT                   /locus_tag="Acfer_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: Os06g0589300; hypothetical protein"
FT                   /db_xref="GI:284047417"
FT                   /db_xref="GeneID:8736466"
FT                   /translation="MAQILLPLFLFCVSLLPAAYLRYYPFRSIVRPSTRHFLLCGHLYI
FT                   FLFEFVLLAGLFGRGLMKFETGTFQFLYYFCYLPYLLLLVFTVRPFWLRHLFVLGLQAI
FT                   YMILIHTLCLEIFKLFLPEAWHTNRVLPYFSLYLGLFLLGMPLALKVLGKLFTREQLTS
FT                   PRPAFWTWLGPIPLLLCYYHANQGYFILDPEILFHPFFQLYILITLGMLVSVALLLVRS
FT                   LQGGLRQTQTMLQVKEQNLRLQGQLNVLNDYAAALRKEQQELAILRHDSRHQLRLLGEL
FT                   AENGQFGEAEKHLLKLRKEVADK"
FT                   /protein_id="YP_003397756.1"
FT   gene            37911..39260
FT                   /db_xref="GeneID:8736467"
FT                   /locus_tag="Acfer_0033"
FT   CDS_pept        37911..39260
FT                   /locus_tag="Acfer_0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dhd:Dhaf_2424 signal transduction histidine
FT                   kinase regulating citrate/malate metabolism"
FT                   /db_xref="GI:284047418"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="GeneID:8736467"
FT                   /translation="MSPLFETILGPLVFVLIFQPFYLLQILPFWNFLEPDRKKFIRNGW
FT                   LLLFFLDVGLTMGLVRSGVFSSIPRAYWACGYIIWIPQFLLSFLTTRKYWVGHLFILSF
FT                   RVLLSSCFYTFLWHFFLYFWPESAFSSMYFWQILFYGAECLLIFPFVLRFLTRTFSHFR
FT                   EAAARRYWRLTALIPMVLAGETLYVSVYDSQERYFDLLEARILLLLITVLIMASIRTAQ
FT                   QEVYDEISAREEKHQLEQQVVSAANYVKMSRESRQRLEAIYREKRDHLDQLLDLVRRKD
FT                   RVGVLTYIEELGEEFNSTKLPQYCRNPLINAALTVYLSRAREEGIPTTVSVDLPQDLIC
FT                   SGDLSIVLSNLVENALIASEKQPEDRRNITVLALRHGDMLNILVKNMFDAPVQLGEDGL
FT                   PVTHVKGHGIGMKSLARFRDKYGASVLCQQKEGWFLTYLQLDMRAKGVGD"
FT                   /protein_id="YP_003397757.1"
FT   misc_feature    <38562..39185
FT                   /note="Signal transduction histidine kinase regulating
FT                   citrate/malate metabolism [Signal transduction mechanisms];
FT                   Region: CitA; COG3290"
FT                   /db_xref="CDD:33099"
FT                   /locus_tag="Acfer_0033"
FT   misc_feature    38937..39206
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Acfer_0033"
FT   gene            complement(39288..40016)
FT                   /db_xref="GeneID:8736468"
FT                   /locus_tag="Acfer_0034"
FT   CDS_pept        complement(39288..40016)
FT                   /locus_tag="Acfer_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   dhd:Dhaf_2425 two component transcriptional regulator,
FT                   LytTR family"
FT                   /db_xref="GI:284047419"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:8736468"
FT                   /translation="MLHIAICDDQADQIQKIREASEKYFQNRKEHVDYQTFENAFAFIE
FT                   AVDKGDFFDIVLLDVCMPGILGTDVARELRDHHSRAEIIFLTTSDEFAVEAFEVKATDY
FT                   LLKPFTQAQFSKAMDRAIAYIRQRNSAKVIFRLVGGGVRVEEIAQILFLESHGHVLEVY
FT                   LADGSTLETRKSGQEMKTDLDKIAPGQFVSPNKGYLVNLSAIHMIKTDYVEIQGHQIPL
FT                   GKRKYRDFQEQYFQFMFAPK"
FT                   /protein_id="YP_003397758.1"
FT   misc_feature    complement(39315..40016)
FT                   /note="Response regulator of the LytR/AlgR family
FT                   [Transcription / Signal transduction mechanisms]; Region:
FT                   LytT; COG3279"
FT                   /db_xref="CDD:33090"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(39651..40001)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(order(39693..39698,39705..39707,39756..39758,
FT                   39816..39818,39840..39842,39990..39995))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(39840..39842)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(order(39816..39824,39828..39833))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(39690..39698)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0034"
FT   misc_feature    complement(39321..39599)
FT                   /note="LytTr DNA-binding domain; Region: LytTR; cl04498"
FT                   /db_xref="CDD:156100"
FT                   /locus_tag="Acfer_0034"
FT   gene            40565..45937
FT                   /db_xref="GeneID:8736469"
FT                   /locus_tag="Acfer_0035"
FT   CDS_pept        40565..45937
FT                   /locus_tag="Acfer_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /codon_start="1"
FT                   /product="S-layer domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: S-layer domain protein; YadA domain protein;
FT                   Haemagluttinin domain protein; Gp5 domain protein; KEGG:
FT                   sep:SE2249 streptococcal hemagglutinin protein"
FT                   /db_xref="GI:284047420"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="GeneID:8736469"
FT                   /translation="MNKIYKVIWNKTRGMYMVVSELAKGQSKDGRRAVGRKKVAQTAAA
FT                   LAVFFSIVSMGGTSFAADTTKVDSSTSGTAVEVYTKDGTDSKAAELDTRITNVKEYLEK
FT                   QTSATYVSKADAAVQDGAIVKADKTIGENVTNLDAALAKETAARIGADKAQDKVIQAVN
FT                   DNLVQSVTTINKNVADGFTALNQADAKEAAAREAKDNELNERITNEANEIHKTTNQLQG
FT                   DLATETAAREAGDTALNIRITNVKAYLEQQTSDKYVSKADAAVQDGAIVKANKTIGENV
FT                   TNLDAALASETAARIGADKAQDKVIQTVNDNLVQSVNTINQNMAAGFNALSQADANELA
FT                   GRVAADTELAKAVNNGLSLDQDNVLQKNTTSVEEDGTVTTSKEAATTLVMNKDGNNQIT
FT                   LSENGIKVGLNSTVQDAKGFYAGGDNAEAAKAALNADGSIKGADGAFAVDTSGNVTSGN
FT                   VTSTGTVQGTTLTDGKGASMSNGVVTGKTLTDGTASLSNGNLTGAHNITADGTITGATL
FT                   TDGKATISNGNIKTNGGFIQTGGGNVNTQGGEVRTNGGKVATSGGEINTGSGAIKTVGG
FT                   DILTAGGKLNTSGGDIAAGTGNISGQNITASGVLRGDSLTVAKGMTGHSLTLTGGDLDA
FT                   GAGTIKTTGKVQAGTLETTGDATIGGDLDVKGDLSVEGKFNANTLSSKLDENNYTTING
FT                   GKTQSMNLKMDAATGETKASASTFDEKGSNTWAKDDDSIGKSTVTADSISQKLSNTGDN
FT                   PTAYAESTMSQGTDNKYTMTDTVKDGDKTNVAFQSATESSDVITEGSGDSAKTSTFRQK
FT                   IDQILQEIRTSDEIYSKIDQTVNKMNSTVRDGANSTSVEQGTQNITHTAEQGTISNIAK
FT                   DLVNTATGNMLNTIGGEMKTTVTGDVTEDYKANLDTKVGGNETRTVEGTLTEMVTGDVT
FT                   EDYKANLSTTVGGNQTTTVTGDSSLTAENITNEAKNKITNKAIDVETDATSSIVQKVTN
FT                   DAGSNTSTQLSYQTKEEMSQADGKTASYLRGAAEEKSQLIDGSQKTTIDTIAGQTNTNI
FT                   TDGTNTSNDLQKADQIASSVTDGTNTTVVNQNAGSLASSITDGTKANNTNSTVDKSEQL
FT                   IKASDTQYSATSKTATKMEDALVSGGSVIDVIKNLDDAANPFIGSAVTDGTNSTGITQT
FT                   AKDITNTAKNGTIANEAKDITNNAAENMTNTVGKDLTTTVGGEMKTTVTGDVTEDYKAN
FT                   LSTTVGGNQTTTVTGDSSLSAKNITNTATEKLSNAAAEIENSASTSITDKVGANVERTM
FT                   TTKKISESVKDGTKSNSFSKTAEKDINIITDGTNTSTLSQLADSVNTSLKNGTQSLNNT
FT                   KTVTEDVTKVTDKNTGAFSSSSQKADAMTNTVKNGSKSNTVTETAATSEQKLVSGNIID
FT                   ILKDAENGYVNTTVTSSDGASSTSVQQGTADITNTAKQGTITNEAKDLVNKAAENITNT
FT                   AGNRIQDKVGTTTVTTTDGLTKLTNEAGNHKTQMDYAEVLQNLSVGGNAAVAGNVTASS
FT                   YKVADKTYIDQNGINANNQKVTNVADGEVAEGSTDAVNGGQLHATNQRVSTVENRMDGV
FT                   ENRVDRVENRVDNLDNRIDKVGASAAAMANLHPMDFDEDSKVSVAAAVGSYRSETAGAL
FT                   GVFYRPTDRVMLNVSTSFGNGENMVGGGVSFKLGKSSKRLQQAEATNAALSKQVTNLQN
FT                   RLDALLGVLNPNLSKAFPDVPANHWAYEAVSRLAGNDIIQGYEDGKYHGERTMSRYEMA
FT                   EIIYNALSKGAKAEAKLVEEFRPELQAMAAQRKA"
FT                   /protein_id="YP_003397759.1"
FT   misc_feature    <43130..43357
FT                   /note="baseplate hub subunit and tail lysozyme;
FT                   Provisional; Region: 5; PHA02596"
FT                   /db_xref="CDD:164991"
FT                   /locus_tag="Acfer_0035"
FT   misc_feature    45356..45571
FT                   /note="YadA-like C-terminal region; Region: YadA;
FT                   pfam03895"
FT                   /db_xref="CDD:146496"
FT                   /locus_tag="Acfer_0035"
FT   misc_feature    45701..45832
FT                   /note="S-layer homology domain; Region: SLH; pfam00395"
FT                   /db_xref="CDD:144111"
FT                   /locus_tag="Acfer_0035"
FT   gene            complement(46039..47109)
FT                   /db_xref="GeneID:8736470"
FT                   /locus_tag="Acfer_0036"
FT   CDS_pept        complement(46039..47109)
FT                   /locus_tag="Acfer_0036"
FT                   /gene_family="HOG000218045" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /codon_start="1"
FT                   /product="tRNA(5-methylaminomethyl-2-thiouridylate)-methyl
FT                   transferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tRNA (5-methylaminomethyl-2-thiouridylate)-
FT                   methyltransferase; PFAM: tRNA methyl transferase-like;
FT                   KEGG: cdf:CD1281 putative tRNA (5-methylaminomethyl-
FT                   2-thiouridylate)-methyltransferase"
FT                   /db_xref="GI:284047421"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR018318"
FT                   /db_xref="GeneID:8736470"
FT                   /translation="MKALIAMSGGVDSSVSAKLMQDAGYDCIGCNMKLYNNPDAGYCST
FT                   KTCCSLSDVEDARSVCARLGMPFYVFNYTEEFKHDVMEKFARSYTLGHTPNPCIDCNKF
FT                   LKFGALYQRARELGCDCVVTGHYARIRKNETTGKYELLKALDPKKDQSYVLYNLTQEQL
FT                   AHTCFPLGGYHKTHTREIAEENGFINSHKPDSQDICFVPNGQYTDAVQRILDYRPQPGP
FT                   FLDLEGNVIGQHRGIIYYTLGQHKHLGLNQPDFPLYVVKIDPKKNAIVVGPSEALFSRK
FT                   ASVGEANWISGEVPAGPVRCQVKVRYRQDAQPATVTPTGKDTFTIQFDEPQRAITPGQA
FT                   AVLYDGEVVLGGGTIE"
FT                   /protein_id="YP_003397760.1"
FT   misc_feature    complement(46042..47109)
FT                   /note="tRNA-specific 2-thiouridylase MnmA; Reviewed;
FT                   Region: mnmA; PRK00143"
FT                   /db_xref="CDD:166820"
FT                   /locus_tag="Acfer_0036"
FT   misc_feature    complement(46045..47106)
FT                   /note="tRNA methyl transferase. This family represents
FT                   tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase
FT                   which is involved in the biosynthesis of the modified
FT                   nucleoside 5-methylaminomethyl-2-thiouridine present in the
FT                   wobble position of some tRNAs...; Region: tRNA_Me_trans;
FT                   cd01998"
FT                   /db_xref="CDD:30185"
FT                   /locus_tag="Acfer_0036"
FT   misc_feature    complement(order(47011..47013,47017..47019,47071..47082,
FT                   47086..47094))
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30185"
FT                   /locus_tag="Acfer_0036"
FT   gene            complement(47121..48272)
FT                   /db_xref="GeneID:8736471"
FT                   /locus_tag="Acfer_0037"
FT   CDS_pept        complement(47121..48272)
FT                   /locus_tag="Acfer_0037"
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /codon_start="1"
FT                   /EC_number="2.8.1.7"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   tpd:Teth39_0280 cysteine desulfurase"
FT                   /db_xref="GI:284047422"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="GeneID:8736471"
FT                   /translation="MFVYADNAATTRVLPKVLEAMLPYFTEQYGNPSSTYPLGQEASRA
FT                   LIGSRETIAGLLGCRPGEITFTSGGSEADNQILRTAATWGKKQGRTHLISSAIEHHAIL
FT                   HTLEALQAEGFTVTLLPVNREGQVEPAALEQALTPETALVSIMAANNETGAIQPIARLA
FT                   AMAHARGALFHTDAVQALGHIPLTLKDTDIDFLSGSAHKFHGPKGVGILFARRGIELES
FT                   LIFGGEQERGKRAGTENVPGIVGMAAALEEAIRNLEANASRMAAARDALEQQLLTLPGT
FT                   RVHSGQVPRLPGHLNMAFDGVPAEALLPVLGMAGICVSAGSACASGSPEPSHVLLALGC
FT                   TPEEARCSLRFSLGDDITLEQVHFIVETVTREVARLRKLHQQA"
FT                   /product="Cysteine desulfurase"
FT                   /protein_id="YP_003397761.1"
FT   misc_feature    complement(47415..48266)
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Acfer_0037"
FT   misc_feature    complement(order(47667..47669,47676..47678,47736..47738,
FT                   47745..47747,47829..47831,48051..48053,48060..48065))
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0037"
FT   misc_feature    complement(47667..47669)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0037"
FT   gene            48517..48801
FT                   /db_xref="GeneID:8736472"
FT                   /locus_tag="Acfer_0038"
FT   CDS_pept        48517..48801
FT                   /locus_tag="Acfer_0038"
FT                   /gene_family="HOG000040440" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S6"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: Ribosomal
FT                   protein S6, bacterial-like; KEGG: drm:Dred_3308 30S
FT                   ribosomal protein S6"
FT                   /db_xref="GI:284047423"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="GeneID:8736472"
FT                   /translation="MNNYEVMYIVKPVEEDAFNAVVKKFDDLLVANGATIEKTDKWGKK
FT                   RLAYAIQDFNDGLYVLTTFAAEPAAVKELDRVMKITDDILRHMIIRKGE"
FT                   /protein_id="YP_003397762.1"
FT   misc_feature    48520..48792
FT                   /note="Ribosomal protein S6; Region: Ribosomal_S6; cl00414"
FT                   /db_xref="CDD:174188"
FT                   /locus_tag="Acfer_0038"
FT   gene            48815..49258
FT                   /db_xref="GeneID:8736473"
FT                   /locus_tag="Acfer_0039"
FT   CDS_pept        48815..49258
FT                   /locus_tag="Acfer_0039"
FT                   /gene_family="HOG000106484" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: pjd:Pjdr2_6272 single-strand binding
FT                   protein"
FT                   /db_xref="GI:284047424"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="GeneID:8736473"
FT                   /translation="MNRIILLGRLVRDPEVRVTPTEKTVCTFTLAVDRPFASKNGQREA
FT                   DFINIVTWNKTAELCGNSLTKGQRALVEGRLQIRSYDGKDGNKHYMTEVIADRVEFIER
FT                   KGSGNPAAGQQNPPSQNQSSQGGSAGPMGGFGSEVGFDEEIPF"
FT                   /protein_id="YP_003397763.1"
FT   misc_feature    48824..49120
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Acfer_0039"
FT   misc_feature    order(48824..48835,48908..48916,48950..48952,48956..48958,
FT                   49019..49021,49046..49048,49079..49081,49088..49090)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Acfer_0039"
FT   misc_feature    order(48839..48847,48863..48865,48893..48895,48914..48919,
FT                   48944..48949,48953..48955,48959..48961,48965..48967,
FT                   48971..48973,49010..49015,49037..49039,49043..49045,
FT                   49049..49054,49091..49093,49097..49099)
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Acfer_0039"
FT   misc_feature    order(49019..49021,49025..49027,49031..49033,49112..49114)
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Acfer_0039"
FT   gene            49280..49516
FT                   /db_xref="GeneID:8736474"
FT                   /locus_tag="Acfer_0040"
FT   CDS_pept        49280..49516
FT                   /locus_tag="Acfer_0040"
FT                   /gene_family="HOG000218466" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S18"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: dhd:Dhaf_4934 ribosomal protein S18"
FT                   /db_xref="GI:284047425"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="GeneID:8736474"
FT                   /translation="MMKRERGNRRPRRKVCSFCVDKVQEIDYKDAAKLRKFITERGKIL
FT                   PRRISGTCAKHQRQLTIAIKRARNVALLPFTAE"
FT                   /protein_id="YP_003397764.1"
FT   misc_feature    49319..49513
FT                   /note="Ribosomal protein S18; Region: Ribosomal_S18;
FT                   cl00373"
FT                   /db_xref="CDD:174155"
FT                   /locus_tag="Acfer_0040"
FT   gene            49666..50622
FT                   /db_xref="GeneID:8736475"
FT                   /locus_tag="Acfer_0041"
FT   CDS_pept        49666..50622
FT                   /locus_tag="Acfer_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09991"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2232, membrane;
FT                   KEGG: chy:CHY_0038 hypothetical protein"
FT                   /db_xref="GI:284047426"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="GeneID:8736475"
FT                   /translation="MHYHKTSSLVESGILAAVAVLFTLVGNYIPVLDIIVSILWPLPII
FT                   LCGRRNGLKWSILCLLVTGCVVAVLLSPLQALTQCVILGLIGLFMGYAMEKQMSPTQTL
FT                   LMGSLGALLSTVLSALAAYFFMHVNVIEVFFQSIDESVNMSSEIFQTLGMKGMTDVQLA
FT                   QLKKMFELILPAGVLLSAPITAIANYWAARKILGRMGDYYPWFPPFSLWQLPKWLLLPY
FT                   GIGMMLIFFGQNYQDSLVYRGGYTLYMMMNMLLLVQGLSLIRWYVEYRHYPRILLPLSL
FT                   LLTFTLPIASQLVVVLGAYEMVFDLRKIRKPGANKPE"
FT                   /protein_id="YP_003397765.1"
FT   misc_feature    49714..50583
FT                   /note="Predicted membrane protein (DUF2232); Region:
FT                   DUF2232; cl01728"
FT                   /db_xref="CDD:154554"
FT                   /locus_tag="Acfer_0041"
FT   gene            50634..52682
FT                   /db_xref="GeneID:8736476"
FT                   /locus_tag="Acfer_0042"
FT   CDS_pept        50634..52682
FT                   /locus_tag="Acfer_0042"
FT                   /gene_family="HOG000112075" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase and phosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; SMART: GGDEF domain containing
FT                   protein; KEGG: cth:Cthe_2258 phosphoesterase, RecJ-like
FT                   protein"
FT                   /db_xref="GI:284047427"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="GeneID:8736476"
FT                   /translation="MDDKSRRNLWQSVRIGVALLGSVLVIYGIAVNQAICTAIGFISVL
FT                   LVYYLTFRSNRLREAWFNHSMTTVVRNIERANNYASQRIPIGIGVFDKEGHLQWRNRLF
FT                   NEFIAVDVPLATPFEKVMPPPDNNFATLRLRDADKQIKIGDRIYKMLVRRIQITDNPEE
FT                   DTGLALYLTDITDRERQKKRYEEERPVVAYVQFDNYDDAMKGLNENERASLIVDVTKAI
FT                   GGWVEDVHGYFQKYTEDMFVVGMSRKGLTDTISKKFQVLDRVREIKSGNRVSPTISIGV
FT                   AADGRNLAELSQKAQAALDLALGRGGDQAVVQLGDDMSFYGARGSVQAKNTRVRARIVA
FT                   QAIHELMVGADQVFIMGHVNEDYDALGAAIGVAKMALTLNKSCCIVASGQGPSLKKLET
FT                   VSKDQSDRYLSLFVTEEEALKRISSGSILVLVDHHRAMLSASPKILQSIRRRIIIDHHR
FT                   RAEDAITDVMLQYMEPSTSSTCEMVTEILQYFENKLQLSEVEATALYAGILVDTKNFAV
FT                   QTGERTFEAAAFLRRNGADPHMVSLLFKDDEHTVLTRARIITEMKQPLPGLAVAVHRCS
FT                   CQDKDTPVIVAQAADELLTMDDIRASVVFSQNENGVSISARSDGSVNVQVMMEELGGGG
FT                   HQTVAGVQVKGVTAEELMPKVLELAKEQMKESDTDESNPAAGHQEIG"
FT                   /protein_id="YP_003397766.1"
FT   misc_feature    50634..52634
FT                   /note="Predicted signaling protein consisting of a modified
FT                   GGDEF domain and a DHH domain [Signal transduction
FT                   mechanisms]; Region: COG3887"
FT                   /db_xref="CDD:33676"
FT                   /locus_tag="Acfer_0042"
FT   misc_feature    51126..51569
FT                   /note="Class III nucleotidyl cyclases; Region:
FT                   Nucleotidyl_cyc_III; cl11967"
FT                   /db_xref="CDD:164309"
FT                   /locus_tag="Acfer_0042"
FT   misc_feature    51684..52160
FT                   /note="DHH family; Region: DHH; pfam01368"
FT                   /db_xref="CDD:144819"
FT                   /locus_tag="Acfer_0042"
FT   misc_feature    52431..52619
FT                   /note="DHHA1 domain; Region: DHHA1; pfam02272"
FT                   /db_xref="CDD:145431"
FT                   /locus_tag="Acfer_0042"
FT   gene            52642..53094
FT                   /db_xref="GeneID:8736477"
FT                   /locus_tag="Acfer_0043"
FT   CDS_pept        52642..53094
FT                   /locus_tag="Acfer_0043"
FT                   /gene_family="HOG000040336" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: Ribosomal
FT                   protein L9-like; KEGG: chy:CHY_0039 ribosomal protein L9"
FT                   /db_xref="GI:284047428"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="GeneID:8736477"
FT                   /translation="MKVILLQDIKKLGKKGDIIETAEGYGRNYLIPRGMAEEATSRNLN
FT                   QAKQDMQVAKHRAAQAHDEAVVLAAQLEKVTLHMKVKVGANGKLFGSIASKDVADALLT
FT                   QTGMEGVDRRKIEIPETIKSPGVYTATAKLLPDVSAKFKVVVETEE"
FT                   /protein_id="YP_003397767.1"
FT   misc_feature    52642..53088
FT                   /note="50S ribosomal protein L9; Reviewed; Region: rplI;
FT                   PRK00137"
FT                   /db_xref="CDD:166815"
FT                   /locus_tag="Acfer_0043"
FT   misc_feature    52642..52785
FT                   /note="Ribosomal protein L9, N-terminal domain; Region:
FT                   Ribosomal_L9_N; pfam01281"
FT                   /db_xref="CDD:144760"
FT                   /locus_tag="Acfer_0043"
FT   misc_feature    52828..53088
FT                   /note="Ribosomal protein L9, C-terminal domain; Region:
FT                   Ribosomal_L9_C; pfam03948"
FT                   /db_xref="CDD:146531"
FT                   /locus_tag="Acfer_0043"
FT   gene            53236..54567
FT                   /db_xref="GeneID:8736478"
FT                   /locus_tag="Acfer_0044"
FT   CDS_pept        53236..54567
FT                   /locus_tag="Acfer_0044"
FT                   /gene_family="HOG000113195" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /codon_start="1"
FT                   /product="replicative DNA helicase"
FT                   /transl_table="11"
FT                   /note="KEGG: hmo:HM1_0975 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="GI:284047429"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="GeneID:8736478"
FT                   /translation="MEERIPPQNIEAEQSVLGAMLISREAIDKAGEILNEDDFYRPDDR
FT                   TIFSAIMDLHSRNEAVDLVTVTEELRRLGKLDAIGGTAAITALSNAVPTAANVVYHAKI
FT                   VEEKSLRRQLINSATEVAASGYEEDQDIAQTIDQAEQKILAVANRKHSGGVVKIKDIVK
FT                   SAMARIEELYDTKDAFTGLPTGFTDFDKMTSGLQPSDLIIVAARPSMGKSSLVLNIAEH
FT                   VALDGGKSVAFFSLEMSKEQLVQRLLCSQARIDASRLRIGQLQESEWPNLVSAADKLSA
FT                   AKIMLDDTPGMTALEMRSKARRWKNENGLDLIIVDYLQLMQGSSKRASDNRQQEMSDIS
FT                   RSLKGLARELNVPVIALSQLSRSVEQRTSKRPMLSDLRESGALEQDADIVCFIYRDDYY
FT                   NQDTEQKNVAELIVAKHRNGPVGTVPLYFRKDITRFEDLSRRPE"
FT                   /protein_id="YP_003397768.1"
FT   misc_feature    53248..54555
FT                   /note="replicative DNA helicase; Region: DnaB; TIGR00665"
FT                   /db_xref="CDD:161985"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    53248..53556
FT                   /note="DnaB-like helicase N terminal domain; Region: DnaB;
FT                   pfam00772"
FT                   /db_xref="CDD:144390"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    53794..54525
FT                   /note="DnaB helicase C terminal domain. The hexameric
FT                   helicase DnaB unwinds the DNA duplex at the  chromosome
FT                   replication fork. Although the mechanism by which DnaB both
FT                   couples ATP hydrolysis to translocation along DNA and
FT                   denatures the duplex is unknown, a...; Region: DnaB_C;
FT                   cd00984"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    53854..53874
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    order(53869..53874,54181..54183,54310..54312,54418..54420,
FT                   54484..54486,54517..54519)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    54172..54183
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Acfer_0044"
FT   misc_feature    order(54196..54201,54226..54234,54307..54333,54415..54420,
FT                   54454..54459)
FT                   /note="DNA binding loops"
FT                   /db_xref="CDD:29985"
FT                   /locus_tag="Acfer_0044"
FT   gene            54764..56056
FT                   /db_xref="GeneID:8736479"
FT                   /locus_tag="Acfer_0045"
FT   CDS_pept        54764..56056
FT                   /locus_tag="Acfer_0045"
FT                   /gene_family="HOG000033912" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /codon_start="1"
FT                   /product="adenylosuccinate lyase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; Adenylosuccinate lyase-like; KEGG: bhy:BHWA1_00426
FT                   adenylosuccinate lyase"
FT                   /db_xref="GI:284047430"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="GeneID:8736479"
FT                   /translation="MIPRYTSKEMGSIWTEENEDRNIVKVEVTACEAMNKLGIVPDDAL
FT                   HDIQTKADFDLDRVHEIEKTTNHDIISLLTSVAEHVGDASKYIHKGLTSNDVKDTAMGL
FT                   MMKHSAEILIREEKELHEILKSQAQKYRHTLCVGRTHGIHAEPMTFGLKFLLWMSETER
FT                   NIERLEMAKKYISVGKLSGAIGTYSNIDPFVEKYVCEKLGLTPVPIANQVVQRDRHAFY
FT                   LSTIAVCGATLEKMATEVRHLQRTEVREAEEYFAPGQKGSSAMPHKRNPITCEKVCGMA
FT                   RVLRGNAEAAIENVALWHERDISHSSVERIIIPDSTILLDHMLRKMKDIMGKMLVYPEA
FT                   MLRDLNLTGGLIYSQNLLIALVSKGVLREDAYKWVQRNAMARWMEGADFKTNVEADPDI
FT                   DKYLTKEEVEACFEPKHMLKHVDEIYARFGM"
FT                   /protein_id="YP_003397769.1"
FT   misc_feature    54764..56050
FT                   /note="adenylosuccinate lyase; Provisional; Region:
FT                   PRK07492"
FT                   /db_xref="CDD:168973"
FT                   /locus_tag="Acfer_0045"
FT   misc_feature    54773..55897
FT                   /note="Adenylsuccinate lyase (ASL)_subgroup 1; Region:
FT                   Adenylsuccinate_lyase_1; cd01360"
FT                   /db_xref="CDD:176464"
FT                   /locus_tag="Acfer_0045"
FT   misc_feature    order(54806..54811,54968..54970,54995..54997,55022..55027,
FT                   55031..55036,55178..55195,55199..55201,55217..55222,
FT                   55229..55231,55238..55243,55259..55264,55280..55282,
FT                   55310..55321,55328..55330,55334..55336,55382..55384,
FT                   55388..55393,55412..55414,55424..55426,55445..55447,
FT                   55466..55468,55478..55480,55484..55489,55493..55498,
FT                   55568..55573,55586..55588,55598..55600,55607..55612,
FT                   55616..55621,55628..55633,55640..55648,55652..55675,
FT                   55682..55687,55691..55696,55706..55708,55826..55828,
FT                   55838..55840,55847..55852,55865..55870)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176464"
FT                   /locus_tag="Acfer_0045"
FT   misc_feature    order(54965..54967,55028..55030,55184..55186,55397..55399,
FT                   55565..55567,55571..55573,55586..55588)
FT                   /note="active site"
FT                   /db_xref="CDD:176464"
FT                   /locus_tag="Acfer_0045"
FT   misc_feature    55808..56050
FT                   /note="Adenylosuccinate lyase C-terminus; Region: ADSL_C;
FT                   pfam10397"
FT                   /db_xref="CDD:150980"
FT                   /locus_tag="Acfer_0045"
FT   gene            56077..57366
FT                   /db_xref="GeneID:8736480"
FT                   /locus_tag="Acfer_0046"
FT   CDS_pept        56077..57366
FT                   /locus_tag="Acfer_0046"
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /codon_start="1"
FT                   /EC_number="6.3.4.4"
FT                   /transl_table="11"
FT                   /note="KEGG: bhy:BHWA1_01817 adenylosuccinate synthase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="GI:284047431"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="GeneID:8736480"
FT                   /translation="MSSVVVIGSQWGDEGKGKIVDYLAQQADAVVRYSGGSNAGHTVVV
FT                   NDVSYKLRLLPSGILYRDKTCILGNGVVINPRVVLQEIAEMKAKGVDTSNLLISDRAHV
FT                   VFPYHEKQDELQEAALGDAKIGTTKGGIGPCYMDKYARTGIRVCDLMNKDILAEKLKRN
FT                   LAAKNALFTKVYGAEPLEYEPMLKAYLGYAEELRPHVTDTSVALGNIFDANKKVLFEGA
FT                   QATFLDIDYGTYPYVTSSNPTAGNAATGSGVGPRFIDHVVGVVKAYTTRVGEGPFVCEL
FT                   FDTDGPGTYLRNTGHEFGTVTGRPRRCGWLDAFMVKYAARLNSMDALAITRLDILDGLD
FT                   EIKMCTGWTIDGEPIQHIPADLSILAKAQPVYETFKGWKKDISGVRSYGDLPKEAQAYL
FT                   ARLSEVVGVEIGIVSVGPNRDQTFCLKEFF"
FT                   /product="adenylosuccinate synthetase"
FT                   /protein_id="YP_003397770.1"
FT   misc_feature    56077..57363
FT                   /note="adenylosuccinate synthetase; Provisional; Region:
FT                   PRK01117"
FT                   /db_xref="CDD:167161"
FT                   /locus_tag="Acfer_0046"
FT   misc_feature    56083..57282
FT                   /note="Adenylosuccinate synthetase (AdSS) catalyzes the
FT                   first step in the de novo biosynthesis of AMP. IMP and
FT                   L-aspartate are conjugated in a two-step reaction
FT                   accompanied by the hydrolysis of GTP to GDP in the presence
FT                   of Mg2+. In the first step, the r-...; Region: AdSS;
FT                   cd03108"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Acfer_0046"
FT   misc_feature    order(56113..56115,56119..56127,56194..56202,56206..56208,
FT                   57070..57072,57076..57078)
FT                   /note="GDP-binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Acfer_0046"
FT   misc_feature    order(56119..56121,56128..56130,56197..56199)
FT                   /note="ACT binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Acfer_0046"
FT   misc_feature    order(56188..56190,56449..56451,56458..56460,56743..56745,
FT                   56788..56790)
FT                   /note="IMP binding site; other site"
FT                   /db_xref="CDD:73337"
FT                   /locus_tag="Acfer_0046"
FT   gene            57719..59263
FT                   /db_xref="GeneID:8736481"
FT                   /locus_tag="Acfer_R0005"
FT   rRNA            57719..59263
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736481"
FT                   /locus_tag="Acfer_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            59640..62543
FT                   /db_xref="GeneID:8736482"
FT                   /locus_tag="Acfer_R0006"
FT   rRNA            59640..62543
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736482"
FT                   /locus_tag="Acfer_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            62774..62889
FT                   /db_xref="GeneID:8736483"
FT                   /locus_tag="Acfer_R0007"
FT   rRNA            62774..62889
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736483"
FT                   /locus_tag="Acfer_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(63155..64390)
FT                   /db_xref="GeneID:8736484"
FT                   /locus_tag="Acfer_0047"
FT   CDS_pept        complement(63155..64390)
FT                   /locus_tag="Acfer_0047"
FT                   /gene_family="HOG000282013" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /codon_start="1"
FT                   /product="sodium/glutamate symporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sodium/glutamate symporter; PFAM:
FT                   sodium/glutamate symporter; KEGG: fnu:FN1801
FT                   sodium/glutamate symport carrier protein"
FT                   /db_xref="GI:284047432"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="GeneID:8736484"
FT                   /translation="MSIIMLKNILTFKADAVFTAALAAVMLLLGYWVKGKSPALRKYCI
FT                   PAPVVGGFLFMFITFIGHQTGAYGFKFDTYFQDPFMLAFFTTVGLGASITLLKKGGGLL
FT                   IIYWLISGIVSICQNGIGIAFSKIFGIEAPYALLASAISMIGGHGAAAAYGKTFVSMGY
FT                   PAGLEVGMAAATFGLISAVLVGGPVARMLIEKYDLKPDTSENFDTDVENVNASSREKLS
FT                   SLDIIKNVTAILCCMAIGSMISGWIGKLIHMSFPTYVGAMFTAVILRNLNEKYHFYNFN
FT                   FSLVDGIGDVMLNLYLAIALMTLRLWELSGLLGGVVLVVAAQVVFMVLACRFVIFRLLG
FT                   GNYDAAVMCAGLCGHGLGATPSAIVNMTAVKDKYGMSRKAFMIVPIVGAFLVDVIYQPQ
FT                   TIAFIKFFVMPK"
FT                   /protein_id="YP_003397771.1"
FT   misc_feature    complement(63170..64303)
FT                   /note="Na+/glutamate symporter [Amino acid transport and
FT                   metabolism]; Region: GltS; cl12073"
FT                   /db_xref="CDD:159733"
FT                   /locus_tag="Acfer_0047"
FT   misc_feature    complement(63266..64303)
FT                   /note="Sodium/glutamate symporter; Region: Glt_symporter;
FT                   pfam03616"
FT                   /db_xref="CDD:112434"
FT                   /locus_tag="Acfer_0047"
FT   gene            64689..66107
FT                   /db_xref="GeneID:8736485"
FT                   /locus_tag="Acfer_0048"
FT   CDS_pept        64689..66107
FT                   /locus_tag="Acfer_0048"
FT                   /gene_family="HOG000292455" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /codon_start="1"
FT                   /product="YidE/YbjL duplication"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; KEGG: fnu:FN1450 integral
FT                   membrane protein"
FT                   /db_xref="GI:284047433"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="GeneID:8736485"
FT                   /translation="MQFNLIAFIFNPLVLLFATMALGNLFGELKFRKFKFGITGTLFIG
FT                   LGIGYFLTRYAATFAKGSKYYASAMKVMQGKVIDGSLMNLALLIFIVGTGLLAAKDMKY
FT                   AINKFGKQFVALAIFIPFVGAVASYGFSQALDNLSPFQITGTYTGALTSSAGLAAATES
FT                   SDSESRRLAQDFANQSQKAQKKILAIVNGAKVRDAKLRGTAVPDTMTLENTKSLSQEDV
FT                   EVFVTEAKAGVGVGHSIGYPFGVLFLILGINVIPKIFGFDVEEEKKKYFAQKAIDIKNN
FT                   EKLAASTMPEVPMDFVGFSLAAFLGYVLGSIKIYMGPLGMFSLGSTGGAILVSLGLGSI
FT                   GKVGPVNFRMNSTVLGKMRTYFLSVFLAGTGLNYGFRVIDAITGSGYMIVIISSLVAIL
FT                   SVLFGFLLGRYAFHINWTLLSGAITGGMTSAPGLGAAVDALECDEPAVSYGATQPLATL
FT                   FMVIFSIIIHKLPI"
FT                   /protein_id="YP_003397772.1"
FT   misc_feature    64719..66104
FT                   /note="Predicted permease [General function prediction
FT                   only]; Region: COG2985"
FT                   /db_xref="CDD:32804"
FT                   /locus_tag="Acfer_0048"
FT   misc_feature    65580..66095
FT                   /note="Predicted Permease Membrane Region; Region:
FT                   Asp-Al_Ex; cl06061"
FT                   /db_xref="CDD:141906"
FT                   /locus_tag="Acfer_0048"
FT   gene            complement(66408..67349)
FT                   /db_xref="GeneID:8736486"
FT                   /locus_tag="Acfer_0049"
FT   CDS_pept        complement(66408..67349)
FT                   /locus_tag="Acfer_0049"
FT                   /gene_family="HOG000216890" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.2"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutaminase, core; KEGG: cpr:CPR_1963
FT                   glutaminase"
FT                   /db_xref="GI:284047434"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="GeneID:8736486"
FT                   /translation="MVMDKEEIQRILEKALEEGRNVLYEGRVASYIPELAKANSGNLGV
FT                   CLMRKDGTEYSAGDCNIPFTMQSISKTFSLILALQTAGYDKVFSKIGMEPTGDRFDSIL
FT                   QLELKDWRPFNPMINAGAIVTASCIESPDPFQSFLDLVRRLCANPRISLNESVYRSEKK
FT                   TGTRNRSIAYLLKSDNVLDGEPEEVLDVYFRMCSVMVTARDLAHYGMILSNHGVDPQTG
FT                   EQLVDSTIVRIVTTLMMLCGMYDESGEYAVKVGMPSKSGVGGGICAIARHGIGIGTFGP
FT                   MLNKKGNSVGGERILRILSESLGLHVFDTKEF"
FT                   /product="Glutaminase"
FT                   /protein_id="YP_003397773.1"
FT   misc_feature    complement(66426..67316)
FT                   /note="Glutaminase; Region: Glutaminase; cl00907"
FT                   /db_xref="CDD:174450"
FT                   /locus_tag="Acfer_0049"
FT   gene            complement(67368..68774)
FT                   /db_xref="GeneID:8736487"
FT                   /locus_tag="Acfer_0050"
FT   CDS_pept        complement(67368..68774)
FT                   /locus_tag="Acfer_0050"
FT                   /gene_family="HOG000255107" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /codon_start="1"
FT                   /product="amino acid carrier protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: apr:Apre_0099 amino acid
FT                   carrier protein"
FT                   /db_xref="GI:284047435"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="GeneID:8736487"
FT                   /translation="MMEFLDAVDSILYYPILLVVMGAAGLYFSIRMGFVQVRWLPEAIR
FT                   LLMVKPQDGNGTSPFQALMVSTAACVGTGNIIGISTAICLGGPGAAFWMTVMAIIGAAS
FT                   SFTECTLAQIFKRRKEDGSAYGGPAYYIEDALHNKAMATAFVVFLLLTYSFGFNLLCSY
FT                   NVQSTFSVYSFYHPDTTPAVIGAVMAVLVGICVMGGAKAIEKAAGILVPFMGVAYALVT
FT                   LVVLVLNFQEVPRVFEAILADAFNFRAIFSGIAGSCLVMGIKRGLYSNEAGVGSAPNAA
FT                   AAATTTHPVKQGLVQMLSVYIDTVILCNATAFMCLVSGVPGNADNAGALWVQTSLHKVL
FT                   GDFGPLFITVSMLVFSFTTLIGNIYYCENGLAYLNHKRIPSRGFMKGFHLYAVLVVFLG
FT                   AIIPMAAAWDLADIMMGGMTLINLTACVLLGGVVVHAYEDYKKQKTAGLDPQFKGTSIG
FT                   LKPEELDFWK"
FT                   /protein_id="YP_003397774.1"
FT   misc_feature    complement(67428..68774)
FT                   /note="Sodium:alanine symporter family; Region:
FT                   Na_Ala_symp; cl00548"
FT                   /db_xref="CDD:163871"
FT                   /locus_tag="Acfer_0050"
FT   gene            complement(68875..69828)
FT                   /db_xref="GeneID:8736488"
FT                   /locus_tag="Acfer_0051"
FT   CDS_pept        complement(68875..69828)
FT                   /locus_tag="Acfer_0051"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: ere:EUBREC_1085 hydrogen peroxide-inducible
FT                   genes activator"
FT                   /db_xref="GI:284047436"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736488"
FT                   /translation="MDTNNLRYFAAVAQYGSITRAARAMYISQPQLSHIIKQLEKEMGL
FT                   TLFRRTSQGTRLTLDGQRILAHSKVILREMDQLRHLSTARKQDCGCLNVSMTRFSHTAE
FT                   CFNEICRRYQDAESFSNHLCEAATLDVIAQVKNGYSNVGVIHMATRRDDLETYFAQQGL
FT                   HYIPLASFPPYVCLSAEHELVRRFGRKGIHIQELQDYGFVRYIGQYEDFIYHISTEKGP
FT                   IDLNDTRKVIYVNDRQEQMALLSRTNFFTVGIMEFLGQDSLYKVVSVPLLGCSEHLRFG
FT                   LILREGAMLSRMENDFIQLLRDRYARLQTETTSSAL"
FT                   /protein_id="YP_003397775.1"
FT   misc_feature    complement(68902..69828)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0051"
FT   misc_feature    complement(69643..69819)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0051"
FT   misc_feature    complement(68911..69465)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Acfer_0051"
FT   gene            69988..70611
FT                   /db_xref="GeneID:8736489"
FT                   /locus_tag="Acfer_0052"
FT   CDS_pept        69988..70611
FT                   /locus_tag="Acfer_0052"
FT                   /gene_family="HOG000039874" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /codon_start="1"
FT                   /product="formate/nitrite transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   fma:FMG_0291 putative formate/nitrite transporter"
FT                   /db_xref="GI:284047437"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="GeneID:8736489"
FT                   /translation="MTKIIPSSLAAGFCIGLGGAVFLLQTEKLVGAVLFCLGLYTICEM
FT                   QFHLFTGRVCYALEQPLWQWLRFPVIWCGNWLGTGLAAGLLSLTRVGPAARQAAQVLVR
FT                   AKDGDTLLSLFVLGFFCNIFVYIAVEGYKTFPLALGKYLAIFVGITVFIMSGYEHSVAD
FT                   MFYYFMAGRMDPEALVRLLVITAGNVCGGWAAWGARQAGKRAAR"
FT                   /protein_id="YP_003397776.1"
FT   misc_feature    69994..70497
FT                   /note="Formate/nitrite transporter; Region: Form_Nir_trans;
FT                   cl00927"
FT                   /db_xref="CDD:174462"
FT                   /locus_tag="Acfer_0052"
FT   gene            70686..71858
FT                   /db_xref="GeneID:8736490"
FT                   /locus_tag="Acfer_0053"
FT   CDS_pept        70686..71858
FT                   /locus_tag="Acfer_0053"
FT                   /gene_family="HOG000243333" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /codon_start="1"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   dhd:Dhaf_3921 iron-containing alcohol dehydrogenase"
FT                   /db_xref="GI:284047438"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="GeneID:8736490"
FT                   /translation="MNPFQIDIPVKVLFGAGQLNRLHEQALPGKKALIVISSGKSTRAN
FT                   GYLDRTEKELAAAGAAAEVFAGIQANPTLESVGKGAQAARAMGADMIVALGGGSVMDAA
FT                   KAIALMAVNEGNLWDYVGSGTGKGQKYAHRALPVIAITTTAGTGSEVDATSVITNQETH
FT                   EKIGLKFPDLYPCLAIVDPELMLTVPPRLTAFQGFDALFHSLETYVNRKANLMSDMVAS
FT                   TAIRNIGAFLPRAVAQGDDVEARTHMAFANTLSGYAMVLGGCTSEHSLEHAMSAYHEVL
FT                   PHGAGLIMLSLAYFGWLAEHHVCDDRLVDLARFLGRKDASRPEDFLEALASLQKACGVD
FT                   GLKMSEYGITPEEFPKMAENATTAMKGLFLNDRMPLSREDCVAVYQKAYR"
FT                   /protein_id="YP_003397777.1"
FT   misc_feature    70707..71843
FT                   /note="Iron-containing alcohol dehydrogenases-like; Region:
FT                   Fe-ADH1; cd08185"
FT                   /db_xref="CDD:173944"
FT                   /locus_tag="Acfer_0053"
FT   misc_feature    70710..71828
FT                   /note="Iron-containing alcohol dehydrogenase; Region:
FT                   Fe-ADH; pfam00465"
FT                   /db_xref="CDD:144163"
FT                   /locus_tag="Acfer_0053"
FT   misc_feature    order(70794..70796,70974..70982,70989..70991,70998..71000,
FT                   71112..71117,71121..71123,71178..71183,71235..71237,
FT                   71259..71261,71280..71282,71292..71294,71487..71489,
FT                   71499..71501,71532..71534)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:173944"
FT                   /locus_tag="Acfer_0053"
FT   misc_feature    order(71280..71282,71292..71294,71487..71489,71532..71534)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:173944"
FT                   /locus_tag="Acfer_0053"
FT   gene            71971..72837
FT                   /db_xref="GeneID:8736491"
FT                   /locus_tag="Acfer_0054"
FT   CDS_pept        71971..72837
FT                   /locus_tag="Acfer_0054"
FT                   /gene_family="HOG000237145" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: shi:Shel_23190 predicted permease"
FT                   /db_xref="GI:284047439"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:8736491"
FT                   /translation="MNLSFLSPRGRMLLSLAIFGTIGLVRRFIPLGSVPLAFLRAALGC
FT                   LTLLVLMQAGHMPFHWDKLKERAPKLLFSGLLLGLDWVFFFEAFNHTTVAIATLCYYMA
FT                   PVFMLAAAPLVFHETIRRRKLVCAAITIGGMLLVSGVLGSDGNIGDITGVLCALAGAFF
FT                   YAAIIVLSKTIQGLDPYEQTAVQLGTAAFFLLVYCLFTGQMDFQAMTGTGWGLTLLLGV
FT                   VHTGLAYGIYFGSLTQVPAQTTAILSYVDPVVAVCISVFVLQEPITELQLAGICLVLGG
FT                   MISGERK"
FT                   /protein_id="YP_003397778.1"
FT   misc_feature    72028..72819
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Region:
FT                   2A78; TIGR00950"
FT                   /db_xref="CDD:162128"
FT                   /locus_tag="Acfer_0054"
FT   misc_feature    72454..72819
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Acfer_0054"
FT   gene            72970..73236
FT                   /db_xref="GeneID:8736492"
FT                   /locus_tag="Acfer_0055"
FT   CDS_pept        72970..73236
FT                   /locus_tag="Acfer_0055"
FT                   /gene_family="HOG000216136" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07866"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1653"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1653; KEGG:
FT                   ere:EUBREC_0984 hypothetical protein"
FT                   /db_xref="GI:284047440"
FT                   /db_xref="InterPro:IPR012868"
FT                   /db_xref="GeneID:8736492"
FT                   /translation="MENRIFHPGDIVRHFKRERLTEGEKRTNRYLYQIVGPAVHSETRE
FT                   PLMVYQALYGDFGLYVRPYAMFCSEVDHKKYPDVKQKYRFEKV"
FT                   /protein_id="YP_003397779.1"
FT   misc_feature    72994..73233
FT                   /note="Protein of unknown function (DUF1653); Region:
FT                   DUF1653; cl01949"
FT                   /db_xref="CDD:154670"
FT                   /locus_tag="Acfer_0055"
FT   gene            73361..73903
FT                   /db_xref="GeneID:8736493"
FT                   /locus_tag="Acfer_0056"
FT   CDS_pept        73361..73903
FT                   /locus_tag="Acfer_0056"
FT                   /gene_family="HOG000246867" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /codon_start="1"
FT                   /product="BioY protein"
FT                   /transl_table="11"
FT                   /note="PFAM: BioY protein; KEGG: dae:Dtox_4332 BioY
FT                   protein"
FT                   /db_xref="GI:284047441"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="GeneID:8736493"
FT                   /translation="MRLREMVLCGLFIALVAVGALIRIPVGSDVYTLQFMFTLLAGLLL
FT                   GGRLGALAVGTYVLMGLVGIPVFASGGGPSYVLQPTFGYLVGFTVQAWVCGKMARQGEG
FT                   EVTLGRLLTINLVGMVIVYVLGISYFWLSSNYLIQAPIGFWAALWYCGVLQVVPDFLLC
FT                   LGAAFVGLRCRKAGIWV"
FT                   /protein_id="YP_003397780.1"
FT   misc_feature    73361..73894
FT                   /note="BioY family; Region: BioY; cl00560"
FT                   /db_xref="CDD:153855"
FT                   /locus_tag="Acfer_0056"
FT   gene            74091..74777
FT                   /db_xref="GeneID:8736494"
FT                   /locus_tag="Acfer_0057"
FT   CDS_pept        74091..74777
FT                   /locus_tag="Acfer_0057"
FT                   /gene_family="HOG000275033" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /codon_start="1"
FT                   /EC_number="6.3.3.3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG:
FT                   bhy:BHWA1_02061 dethiobiotin synthetase"
FT                   /db_xref="GI:284047442"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="GeneID:8736494"
FT                   /translation="MGKAIFVTGTGTDVGKTYVTGLLVKKIRDAGLDGSYYKAALSGAE
FT                   PDGQGNLVPGDAAWVKETAGLKDPLTDLVTYVYREAVSPHLAARINHRPVELETIREAF
FT                   QKARARHEYLTMEGSGGILCPLRWDERQHLLLEDMIRALDLGCLLVADAGLGTINSTVL
FT                   TVEYLQHRSIPVRGILFNRWKPGDRMQEDNRAMVEELTGIPVLACVKEGDRELEGPLDG
FT                   LLAAYA"
FT                   /product="dethiobiotin synthase"
FT                   /protein_id="YP_003397781.1"
FT   misc_feature    74103..74711
FT                   /note="CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   Region: CbiA; pfam01656"
FT                   /db_xref="CDD:145019"
FT                   /locus_tag="Acfer_0057"
FT   misc_feature    74103..>74204
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:176936"
FT                   /locus_tag="Acfer_0057"
FT   misc_feature    <74388..74720
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:176936"
FT                   /locus_tag="Acfer_0057"
FT   gene            74788..76125
FT                   /db_xref="GeneID:8736495"
FT                   /locus_tag="Acfer_0058"
FT   CDS_pept        74788..76125
FT                   /locus_tag="Acfer_0058"
FT                   /gene_family="HOG000020209" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /codon_start="1"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   amu:Amuc_0493 adenosylmethionine-8-amino-7- oxononanoate
FT                   aminotransferase"
FT                   /db_xref="GI:284047443"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736495"
FT                   /translation="MEHKTMEQRDLDLIWHPCSQMKDYETLPPMVIDHAQGVWLYDIHG
FT                   KAYLDIVSSWWANLLGHRNPVLNARIKSQLDKLEHVIFANFTHEPAITLAERLKVLVPE
FT                   GLCRFQFHDNGSASVEAALKLCFQYWAQTGHPEKQRFMCLTEGYHGETIGALSVGSMDL
FT                   FAKLYQPMMMDNIHVEAPDCFRCPYGKDRDHCRCECFAKAEEAFVQHGKETAAMIVEPL
FT                   LQGSAGMRVYPALYLQKLRALCDAYEVKLIADEIATGFGRTGTLFACGQAGITPDVMCL
FT                   SKGLTGGYMPMSLTVTNQEIYDAFYDDYGKHKAFLHSHTYAGNPLGCAAAHGVLDVLEQ
FT                   DSILPRARKIAQWLTEEMEARFGNHPLVGEIRHIGLIHALELVADKKTKAPFPAEKRLG
FT                   YQFYRKALERGLVLRPLGDVLYFNPPLTITRGELTQAMDILEQVLA"
FT                   /protein_id="YP_003397782.1"
FT   misc_feature    74806..76119
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Acfer_0058"
FT   misc_feature    74809..76074
FT                   /note="adenosylmethionine--8-amino-7-oxononanoate
FT                   transaminase; Provisional; Region: PRK07030"
FT                   /db_xref="CDD:168773"
FT                   /locus_tag="Acfer_0058"
FT   misc_feature    order(75127..75135,75229..75234,75238..75240,75445..75447,
FT                   75547..75549,75553..75558,75634..75636)
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Acfer_0058"
FT   misc_feature    order(75130..75135,75229..75234,75445..75447,75547..75549,
FT                   75556..75558,75634..75636)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Acfer_0058"
FT   misc_feature    75634..75636
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="Acfer_0058"
FT   gene            76347..77582
FT                   /db_xref="GeneID:8736496"
FT                   /locus_tag="Acfer_0059"
FT   CDS_pept        76347..77582
FT                   /locus_tag="Acfer_0059"
FT                   /gene_family="HOG000016999" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /codon_start="1"
FT                   /product="peptidase M24"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M24; KEGG: cth:Cthe_0541 peptidase
FT                   M24"
FT                   /db_xref="GI:284047444"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="GeneID:8736496"
FT                   /translation="MTILEHDILISEDLRRVPREELENRLERLRETLTQQDPGWQMAVI
FT                   TDKLDMYYFTGTMQEGAFMVRPQDAILWVRRSLARALNESLLPEGWIRRMHSYRQPAEY
FT                   YGENLPREVYLDEKHTSLEWLRFFRKYFPFEARKNLDQVLGRLRSVKSDYELALLARSG
FT                   QIHGDVLMQEAPVFLKVGISEAELAIQLYLRMVLKGSQGVARTNRPTGEDAIGLASFGK
FT                   SALVRTAFDGPGGTSGTCVAVQSIGSAFRLLKPGRLVYLDIPCGVDGYNTDKTVVYYFG
FT                   DLDRDPAKEEILRAYNYCLELEKQTMALLKPGAVLGEIYDTVMEDFDPYYEKMFMNGGR
FT                   FLGHSIGMCMDETPVIAGGVKDRVEENMVFAVEPKIALPGLGMVGTENTYRIGPEGPVC
FT                   LTGGSQPLRVVR"
FT                   /protein_id="YP_003397783.1"
FT   misc_feature    76452..77549
FT                   /note="Xaa-Pro aminopeptidase [Amino acid transport and
FT                   metabolism]; Region: PepP; COG0006"
FT                   /db_xref="CDD:30356"
FT                   /locus_tag="Acfer_0059"
FT   misc_feature    76461..76796
FT                   /note="Creatinase/Prolidase N-terminal domain; Region:
FT                   Creatinase_N; pfam01321"
FT                   /db_xref="CDD:144790"
FT                   /locus_tag="Acfer_0059"
FT   misc_feature    76812..77537
FT                   /note="A family including aminopeptidase P, aminopeptidase
FT                   M, and prolidase. Also known as metallopeptidase family
FT                   M24. This family of enzymes is able to cleave amido-,
FT                   imido- and amidino-containing bonds. Members exibit
FT                   relatively narrow substrate...; Region: APP_MetAP; cl00279"
FT                   /db_xref="CDD:174086"
FT                   /locus_tag="Acfer_0059"
FT   misc_feature    order(77046..77048,77130..77132,77163..77165,77376..77378,
FT                   77463..77465,77505..77507)
FT                   /note="active site"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="Acfer_0059"
FT   gene            77678..77986
FT                   /db_xref="GeneID:8736497"
FT                   /locus_tag="Acfer_0060"
FT   CDS_pept        77678..77986
FT                   /locus_tag="Acfer_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047445"
FT                   /db_xref="GeneID:8736497"
FT                   /translation="MTAEETGLLDKQDFLEQKEVIKKQILGNSKLTGTEKRQTLQVLEG
FT                   FEKSVLQGGVRQHGITKAMLKTALPVFGKMSEDKRHNEKELRVLKFLTYFVLQGVRK"
FT                   /protein_id="YP_003397784.1"
FT   gene            77983..78564
FT                   /db_xref="GeneID:8736498"
FT                   /locus_tag="Acfer_0061"
FT   CDS_pept        77983..78564
FT                   /locus_tag="Acfer_0061"
FT                   /gene_family="HOG000238852" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02659"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF204"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   dhd:Dhaf_2300 protein of unknown function DUF204"
FT                   /db_xref="GI:284047446"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="GeneID:8736498"
FT                   /translation="MNALTLFLLAVSLSMDAFAVSVCGGLKMEGRERFKGGLIFGAWFG
FT                   VFQAVMPLVGYELGSHFAKVADTYSHWIIFAILAYIGWNMIQEAGEDQEKEKITGFRTM
FT                   LGLAVATSLDALGVGVGFAFLDIQILPAVLEIGTITFCLSFLGCACGSLIGMWGKARAE
FT                   QAGGFVLLLIGLKAVIEHYGILDNWTPFLF"
FT                   /protein_id="YP_003397785.1"
FT   misc_feature    77983..78531
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1971"
FT                   /db_xref="CDD:32154"
FT                   /locus_tag="Acfer_0061"
FT   misc_feature    78019..78228
FT                   /note="Domain of unknown function DUF; Region: DUF204;
FT                   pfam02659"
FT                   /db_xref="CDD:145682"
FT                   /locus_tag="Acfer_0061"
FT   misc_feature    78313..78504
FT                   /note="Domain of unknown function DUF; Region: DUF204;
FT                   pfam02659"
FT                   /db_xref="CDD:145682"
FT                   /locus_tag="Acfer_0061"
FT   gene            78617..79765
FT                   /db_xref="GeneID:8736499"
FT                   /locus_tag="Acfer_0062"
FT   CDS_pept        78617..79765
FT                   /locus_tag="Acfer_0062"
FT                   /gene_family="HOG000082707" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   dds:Ddes_2317 DNA-directed DNA polymerase"
FT                   /db_xref="GI:284047447"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017962"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="GeneID:8736499"
FT                   /translation="MARQRYIMHVDMDAFFASVEQLDHPEYRGKPVIVGGLSGRGVVST
FT                   CSYEARKFGVHSAMPMATARRLCPQAIYVQGRYGRYTEISREIRQIFQEFSPVVEPLSI
FT                   DEAFLDLTGMEALVGDVYALGPKIKETIRQRTGLTASVGMAPNKFLAKLASDLRKPDGL
FT                   VIIRPEEAAAFIAPLPVGRIFGLGQRSVGALGKMGIRTIGQLAACDPRLLKPLLGKQAE
FT                   EIRDRARGLDNRPVVPDEQRKSLGKENTFPVDLTGRETCLGVLWDLCQQVGWRLRSAGL
FT                   SGCTVTLKVKTASFQLLTRSRTVEEPLAQDEELMEQIRVLAGQLPWTWPVRLLGVSVSH
FT                   LVPAGAQSLAVEDQRQQDRNRALDALKQRFGENIIRKGWGKP"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_003397786.1"
FT   misc_feature    78623..79666
FT                   /note="DNA polymerase IV; Validated; Region: PRK02406"
FT                   /db_xref="CDD:167372"
FT                   /locus_tag="Acfer_0062"
FT   misc_feature    78644..79084
FT                   /note="Y-family of DNA polymerases; Region: PolY; cl12025"
FT                   /db_xref="CDD:176619"
FT                   /locus_tag="Acfer_0062"
FT   misc_feature    79262..79621
FT                   /note="impB/mucB/samB family C-terminal; Region: IMS_C;
FT                   pfam11799"
FT                   /db_xref="CDD:152235"
FT                   /locus_tag="Acfer_0062"
FT   gene            79835..80713
FT                   /db_xref="GeneID:8736500"
FT                   /locus_tag="Acfer_0063"
FT   CDS_pept        79835..80713
FT                   /locus_tag="Acfer_0063"
FT                   /gene_family="HOG000083322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bay:RBAM_037640 hypothetical protein"
FT                   /db_xref="GI:284047448"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:8736500"
FT                   /translation="MERRKKIGVGMVLLGATLWGSSSNSVEYLMVDQHFTWSAILFWRM
FT                   VFTGISFLGISRFQKQDLLAPLKQDGKWMMKFILLGLYLMQVTFFKAIYYSNAATATVL
FT                   QYTMPAILLLMYLVKDWRLPTRREVVAVVLALLGTALIATKGQGAALAVSGEALFYGIL
FT                   GAFGMAFYTAYAAVLLKKYSCFLILGWGSLGNALLLQLFHHPTLEGAVLDIHTAAAFGI
FT                   LFVLGTLVAYYVYLESTKYIPPAETGALAAFEPLSAYFFSVVVMGNRVGPVELVGALCI
FT                   IVMVCVLTRND"
FT                   /protein_id="YP_003397787.1"
FT   misc_feature    79889..80689
FT                   /note="Carboxylate/Amino Acid/Amine Transporter; Region:
FT                   2A78; TIGR00950"
FT                   /db_xref="CDD:162128"
FT                   /locus_tag="Acfer_0063"
FT   misc_feature    79949..80203
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Acfer_0063"
FT   misc_feature    80330..80704
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Acfer_0063"
FT   gene            80827..82122
FT                   /db_xref="GeneID:8736501"
FT                   /locus_tag="Acfer_0064"
FT   CDS_pept        80827..82122
FT                   /locus_tag="Acfer_0064"
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.49"
FT                   /transl_table="11"
FT                   /note="KEGG: cbe:Cbei_0766 O-acetylhomoserine/O-
FT                   acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="GI:284047449"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736501"
FT                   /translation="MSEEKKYHFETLQLHVGQEQADPATDSRAVPIYQTTSYVFRNSQH
FT                   AADRFALKDAGNVYGRLTNPTEDVFEKRIAALEGGVAALATASGAAAVTYAMQALVHAG
FT                   QHIVCATTVYGGTYNLFEHTFPDFGIETTFVDPTKGVHVFEEAVRENTQAIYIESVGNP
FT                   NANLIDIDAVAAIAHKHKIPLVVDSTFATPYLLRPFEHGADVVVHSATKFIGGHGTTLG
FT                   GIIVDSGKFDWVASGRFPWLVDPNPSYHGISFAKDVGPAAYVTYIRTLILRDTGATLSP
FT                   FNAFLLLQGTETLSLRVERQVENALKVVDFLAKDSHVAKVNHPSLPDHPDHELYKKYFP
FT                   NGGISIFTFEIKGGAAAAQKFIDHLKIFSLLANVADVKSLVIHPASTTHSQMNEEELAA
FT                   SGITPATIRLSIGTEHIDDIIDDLKQAFAALD"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /protein_id="YP_003397788.1"
FT   misc_feature    80848..82110
FT                   /note="OAH/OAS sulfhydrylase; Region: OAH_OAS_sulfhy;
FT                   TIGR01326"
FT                   /db_xref="CDD:130393"
FT                   /locus_tag="Acfer_0064"
FT   misc_feature    80902..82110
FT                   /note="CGS_like: Cystathionine gamma-synthase is a PLP
FT                   dependent enzyme and catalyzes the committed step of
FT                   methionine biosynthesis. This pathway is unique to
FT                   microorganisms and plants, rendering the enzyme an
FT                   attractive target for the development of...; Region:
FT                   CGS_like; cd00614"
FT                   /db_xref="CDD:99738"
FT                   /locus_tag="Acfer_0064"
FT   misc_feature    order(80926..80937,80941..80946,81001..81003,81007..81009,
FT                   81085..81090,81094..81099,81166..81168,81181..81183,
FT                   81190..81192,81457..81459,81481..81483,81487..81489,
FT                   81631..81633,81664..81666,81670..81675,81913..81915)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99738"
FT                   /locus_tag="Acfer_0064"
FT   misc_feature    order(81088..81096,81166..81168,81298..81300,81385..81387,
FT                   81451..81453,81457..81462,81487..81489)
FT                   /note="substrate-cofactor binding pocket; other site"
FT                   /db_xref="CDD:99738"
FT                   /locus_tag="Acfer_0064"
FT   misc_feature    order(81088..81096,81166..81168,81385..81387,81394..81396,
FT                   81451..81453,81457..81462)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99738"
FT                   /locus_tag="Acfer_0064"
FT   misc_feature    81460..81462
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99738"
FT                   /locus_tag="Acfer_0064"
FT   gene            82278..83621
FT                   /db_xref="GeneID:8736502"
FT                   /locus_tag="Acfer_0065"
FT   CDS_pept        82278..83621
FT                   /locus_tag="Acfer_0065"
FT                   /gene_family="HOG000072914" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /codon_start="1"
FT                   /product="MATE efflux family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: cpy:Cphy_3173
FT                   MATE efflux family protein"
FT                   /db_xref="GI:284047450"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="GeneID:8736502"
FT                   /translation="MTRTTTKDMTSGNIPRLILEFALPLMIGNVFQMLYNTVDSIVVGN
FT                   FVGTQALAAVSSTTMITNMSVFFFNGFSIGATVIIGKCFGAKDHGLLHRAVETTMAATF
FT                   LLCVLFTVFFFTGTDFMLHFMKTPADVFDQAALYLRIYFAGVTGLLLYNMGSGVLRAVG
FT                   DTKRPLYFLILTSVLNIFLDLLFVLVFHWGIAGVAYATIIAQFISAGATLAVLLRTRDV
FT                   YRFSFRDLCLDGNLLGQIFRVGLPTAIQSIITSFSNIFVQSYINFFGATVMAGWGCYNK
FT                   LDQFIMLPVLSMAMAATTFVAQNIGARQEERANDGTVSSIVLSLAITGTIAALLFIFAD
FT                   FSLRLFTGDEAVIRSGVDFIHVNIFFMMFNCVNQVLAGALRGRGDSMGPMVIMLLSFVL
FT                   VRQIYLYIMTRYISNTPLTVGFGYPVGWATCCVLEVLYFWLYWKHKEG"
FT                   /protein_id="YP_003397789.1"
FT   misc_feature    82305..83615
FT                   /note="Na+-driven multidrug efflux pump [Defense
FT                   mechanisms]; Region: NorM; COG0534"
FT                   /db_xref="CDD:30880"
FT                   /locus_tag="Acfer_0065"
FT   misc_feature    82347..82832
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Acfer_0065"
FT   misc_feature    83013..83474
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Acfer_0065"
FT   gene            complement(83720..84820)
FT                   /db_xref="GeneID:8736503"
FT                   /locus_tag="Acfer_0066"
FT   CDS_pept        complement(83720..84820)
FT                   /locus_tag="Acfer_0066"
FT                   /gene_family="HOG000096626" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01883"
FT                   /codon_start="1"
FT                   /product="peptidase T-like protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: peptidase T-like protein; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; KEGG:
FT                   sth:STH1689 peptidase"
FT                   /db_xref="GI:284047451"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:8736503"
FT                   /translation="MDIIEEFKELVMIDSASGQERAIADVLTAKLRALGFAVTEDRAGD
FT                   TFGGNTGNLTAVREGDRPGAILFCSHMDRVANGLHIRPREKDGCLVSDGTTILAADDVS
FT                   GICAILDGVRRALASRKPLPRLEIAFTVGEESGLWGGRALDLSRFQSPFCYVMDSPGTL
FT                   GRLINGAPGLAKLQAEILGKAAHAGNEPEKGINAAHILCHILDTLKDGRLDEETVANFP
FT                   LMGTGNTATNIVCDRAWVKGESRSRNQEKLEAYMDYFQRHCQEAAAGTGARVRTAAEIS
FT                   FAPFQLAETEPVIRTAVKALEALGIAPRIEQGGGGMDANIFNAKGLPSLGVATGYTKNH
FT                   TLEENLDLKSFIRSGQLVEKLIGMVG"
FT                   /protein_id="YP_003397790.1"
FT   misc_feature    complement(83735..84820)
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases [Amino acid transport
FT                   and metabolism]; Region: ArgE; COG0624"
FT                   /db_xref="CDD:30969"
FT                   /locus_tag="Acfer_0066"
FT   misc_feature    complement(83735..84814)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0066"
FT   gene            complement(84845..86032)
FT                   /db_xref="GeneID:8736504"
FT                   /locus_tag="Acfer_0067"
FT   CDS_pept        complement(84845..86032)
FT                   /locus_tag="Acfer_0067"
FT                   /gene_family="HOG000122989" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CD0651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cdf:CD0651 hypothetical protein"
FT                   /db_xref="GI:284047452"
FT                   /db_xref="GeneID:8736504"
FT                   /translation="MTMWTALLIVLAVFAFGDLISQLTRARLSSLFVIMMTFLVLFIFK
FT                   IIPPDIIKRAGLTTLGPISMVMLLLNMGTTIDLAMLKREWRSVAASCIAMAIAIVSCLV
FT                   LIPFIGRANALAAAPVINGGIIATTTMVKAASDQGLAMTAALAAFLYATQKFVGTLPAS
FT                   YFGLKAARRYVEEFRQLKAEDPDSILDQEELPQDSPRLSWAERNTRRFTIYISLFIGAA
FT                   AAWLGTIGGKLTHNWVGMFLWCMIIGLVLRNLGLVPANLLKKNANASGFFIFGALTAIV
FT                   PSLAKVDFSMLGQLGITVVAVFAVTVAGIILAFKLLPLWKIVGDKDLCIGIAMCQMIGY
FT                   PGTQLISEEISKAVGKTPEEIDYLEKRIGTAYVISGFTSVTVLSIVVATIMAKIL"
FT                   /protein_id="YP_003397791.1"
FT   gene            86269..87237
FT                   /db_xref="GeneID:8736505"
FT                   /locus_tag="Acfer_0068"
FT   CDS_pept        86269..87237
FT                   /locus_tag="Acfer_0068"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /codon_start="1"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ere:EUBREC_1207 phosphoglycerate
FT                   dehydrogenase, putative"
FT                   /db_xref="GI:284047453"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736505"
FT                   /translation="MKFVLSMPLAPAGMEMMKKLGIQWEVGPGINWEAYPDALLESADA
FT                   LIIRLEKCPESVLRRCRNLKVLGRPGMGFENVPVDWCTERGIPVVLAPGANARSVAEHA
FT                   LALIFACAKDLKEMDEENRKGNWGIRAQGKQMELAGKTVGIVGVGGIGSLLAGMCRALG
FT                   MECIGWSHSHNRARVEAAGCRYVETLEEVLRTSDFVSLHIPLLPSTRHCIGARELSLMK
FT                   PTAFLINTARGAVVDEQALADAVNQGVIAGAGVDVYGTEPAVLDNPVFTAPRILCTPHS
FT                   AALTPDSWARMACGAVEGCYAVCQGKEWPGVANPEVWKKKS"
FT                   /protein_id="YP_003397792.1"
FT   misc_feature    86269..87210
FT                   /note="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases [Amino acid transport and metabolism];
FT                   Region: SerA; COG0111"
FT                   /db_xref="CDD:30460"
FT                   /locus_tag="Acfer_0068"
FT   misc_feature    86581..87114
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Acfer_0068"
FT   gene            87337..88902
FT                   /db_xref="GeneID:8736506"
FT                   /locus_tag="Acfer_0069"
FT   CDS_pept        87337..88902
FT                   /locus_tag="Acfer_0069"
FT                   /gene_family="HOG000219570" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SNSL254_A4535"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: see:SNSL254_A4535 hypothetical protein"
FT                   /db_xref="GI:284047454"
FT                   /db_xref="GeneID:8736506"
FT                   /translation="MMTKAVAILGSSGGNLYNLGGKDPESLLGELVRQIKAAGMELAAI
FT                   QFIGAEASMDTARPDTKAALWTWNGTEPQVIFRGTLEEVNREAVLEDEKIAGLIDEGKV
FT                   DGLILASCDPRGANRRAMETAAEQKLAATGTGGTSMALAQSMGLNVVAVSGTTGTTNRT
FT                   RAIANVFALARFWKLSYRPAMNGGVTTEGPDEKSSLLSRISVRGILMASLPGFIAMALT
FT                   LILSKVPGLAYFEKIFNVMIDALPVIVATVAAKQVSGMGDVAIVAGVVTGILSVKGGLI
FT                   GGIIGGILAGILVQFLLLKCLKLNFPATTANIVAGGIAGLAAGLLIYLFIAPLADAVGN
FT                   GIRYVIDWAFSIHPVLCGGLAGLLIWPAIMGGMYHAAILPIILLEMEKTGNSFLGAIDM
FT                   VGLVMVSAGIMAANILAPRRKDDRALAIPGLFINMAFGTFVEAAYPFMFSNKVVMAGAI
FT                   LSAGVGGVAVGYFNVRGTAYVPSIVAPTLSNNVLGFALCMFLSAFCACCITLAANRFTK
FT                   NKEE"
FT                   /protein_id="YP_003397793.1"
FT   misc_feature    <88333..88881
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="Acfer_0069"
FT   gene            complement(89125..90063)
FT                   /db_xref="GeneID:8736507"
FT                   /locus_tag="Acfer_0070"
FT   CDS_pept        complement(89125..90063)
FT                   /locus_tag="Acfer_0070"
FT                   /gene_family="HOG000159795" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: dsa:Desal_0550 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="GI:284047455"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736507"
FT                   /translation="MDLKQIEYIVKIAETGSITRAAEQLFITQSALNQQLLKLEQQLGI
FT                   KLFVRHKHDMTPTSAGRVYLEYGENMLREKREAYNIIHDMAQSSLGDLRLTFSRERGID
FT                   MLVSTYPQFHRKFPGITLRPHEMFVVDQLNCLSRGDTDLGVVTVTEKQKVPDLEFELVR
FT                   KEPLLLAIPRQNPRAVNPARPGTPLEELPYMEVDQCKDSPFVLMFPKSTMRQLIDRILK
FT                   KADYHPYVLFESASIRALLTMVKNNMACTIVAGGYYRYQDKIAFYRIPGDPYWEMCITY
FT                   KKGAYLNKAMLCYKDLIHDYFRIKDPLFVKK"
FT                   /protein_id="YP_003397794.1"
FT   misc_feature    complement(89155..90063)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0070"
FT   misc_feature    complement(89878..90057)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0070"
FT   misc_feature    complement(89191..89733)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0070"
FT   misc_feature    complement(order(89326..89331,89335..89340,89356..89373,
FT                   89686..89706,89710..89712,89722..89724,89731..89733))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0070"
FT   gene            90278..91606
FT                   /db_xref="GeneID:8736508"
FT                   /locus_tag="Acfer_0071"
FT   CDS_pept        90278..91606
FT                   /locus_tag="Acfer_0071"
FT                   /gene_family="HOG000238021" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.40"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.40"
FT                   /transl_table="11"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: dda:Dd703_0843 glucarate dehydratase"
FT                   /db_xref="GI:284047456"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="GeneID:8736508"
FT                   /translation="MTPVITKMEVYPVAGKDSMLLNLSGGHAPYFTRNIVILTDSEGNT
FT                   GVGEVPGGPKITNALEDVKDIVVGTKISDYRNTLLAVKAHLDKNGEEDVRGNQTFDLRT
FT                   GVHVMTAIEAPCLDLLGKFLDMPVCRLLGNGQQRDFVRFLGYLFFVGDRNKTDLPYDHE
FT                   EDSDCEWYRLRNEEALDADSVVALCRAAKEKYGFKDFKLKGGVLPGDEEMKVIKAMKKA
FT                   FPDARMDLDPNGAWKLDDAVRYVSDMHGILTYCEDPCGAEGVYSGREIMSEFRRRTGFP
FT                   TATNMIATDWRQVGHSLESQAVDIILADPHFWTMNGSVRVAQMCHEFGYTWGSHSNNHF
FT                   DISLAMCVQVGAAVPGFYNALDTHWIWQEGRERLTREPMQIVDGGIKVPDKPGLGVEVD
FT                   REQVLKAHELYKKHCLGVRNDAITMQYLIPGWKFDAKSPCLVR"
FT                   /product="Glucarate dehydratase"
FT                   /protein_id="YP_003397795.1"
FT   misc_feature    90281..91603
FT                   /note="glucarate dehydratase; Region: glucar-dehydr;
FT                   TIGR03247"
FT                   /db_xref="CDD:132291"
FT                   /locus_tag="Acfer_0071"
FT   misc_feature    90287..91516
FT                   /note="D-Glucarate dehydratase (GlucD) catalyzes the
FT                   dehydration of both D-glucarate and L-idarate to form
FT                   5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction
FT                   of the catabolic pathway for (D)-glucarate. GlucD belongs
FT                   to the enolase superfamily of...; Region:
FT                   D-glucarate_dehydratase; cd03323"
FT                   /db_xref="CDD:48198"
FT                   /locus_tag="Acfer_0071"
FT   misc_feature    order(90341..90343,90356..90358,90713..90715,90878..90880,
FT                   90884..90886,90968..90970,90974..90976,91043..91045,
FT                   91130..91132,91280..91288,91367..91369)
FT                   /note="active site"
FT                   /db_xref="CDD:48198"
FT                   /locus_tag="Acfer_0071"
FT   misc_feature    order(90503..90508,90515..90517,90644..90649,90665..90676,
FT                   91079..91084,91094..91096,91100..91105,91148..91153,
FT                   91163..91165,91235..91237,91244..91246,91256..91267)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:48198"
FT                   /locus_tag="Acfer_0071"
FT   gene            91638..93050
FT                   /db_xref="GeneID:8736509"
FT                   /locus_tag="Acfer_0072"
FT   CDS_pept        91638..93050
FT                   /locus_tag="Acfer_0072"
FT                   /gene_family="HOG000237113" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /codon_start="1"
FT                   /product="Gluconate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Gluconate transporter; KEGG: msu:MS0688 GntT
FT                   protein"
FT                   /db_xref="GI:284047457"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="GeneID:8736509"
FT                   /translation="MAESTRMVLGLGLGILVMIILVAKTKVHSFIAMLIAALITGIIGG
FT                   MPILTVKVAGKTTVGVINAISTGFGNTLSSTGIIIGLGVMMGAILEKSGAAEKLAISFI
FT                   KLVGKGNEEWALGVTGWVVSIPVFADSAVVMLCPLCKAISKVTGKSVIGLGLSLACGLQ
FT                   LTHVLVPPTPGPLTAAGMLGIDVGQMIAGGAILSIPMLLVIVPYCKWIGKKIYQVVNED
FT                   DEYVRPQQGEQVKLASTELLDQFLNRTDLPGLAISAAPIVVPLVMILTKTVLDLMGADK
FT                   SAGYYYFVALFGSPIVALMIGTLIAIYGLVSDRDTKEVLKMMDDGIKDTGIIMLITGVG
FT                   GSLGYVVRASGIGNVLGQMVVTWPVPAVLIPFCIAALMRICLGSATVAIVTSASLTMPL
FT                   MSQLTISPLLMALSCCVGAISFGYFTDSGFWVWNGMFGVSDLKEQLQCKTAVSMIMAGV
FT                   GLLELLVAQYFI"
FT                   /protein_id="YP_003397796.1"
FT   misc_feature    91821..93038
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0072"
FT   gene            93181..94140
FT                   /db_xref="GeneID:8736510"
FT                   /locus_tag="Acfer_0073"
FT   CDS_pept        93181..94140
FT                   /locus_tag="Acfer_0073"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /codon_start="1"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: oih:OB2844 hypothetical protein"
FT                   /db_xref="GI:284047458"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736510"
FT                   /translation="MYKILVPKALKPVAREFLTKKGYELVSPEATDEASLAKAIADVDA
FT                   VIARTEKYTKTVVDAGKNLKIIARYGIGYENIDLAACDAKNVTVTLARGCNTYSVAEHA
FT                   ISLMLACFRQIPQLNQEVRKGNWKSRDAIETHEARYKTFGSIGIGPIGLEAVKIAHFGF
FT                   QMRILVYDKFVDRSQFPDWVEFVDTLDELMEQADVVSPHLPLNKGTFHIIDEEAISHMK
FT                   PTAVLLNVSRGAIWDEKAVYKALKEGRIAAAGADVFETEPPTPDMPLFSLPNYIGCPHT
FT                   AALTEEAVDAVAMNCAQAIDDLLNGREPKFIINHPEKA"
FT                   /protein_id="YP_003397797.1"
FT   misc_feature    93181..94137
FT                   /note="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases [Amino acid transport and metabolism];
FT                   Region: SerA; COG0111"
FT                   /db_xref="CDD:30460"
FT                   /locus_tag="Acfer_0073"
FT   misc_feature    93493..94026
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Acfer_0073"
FT   gene            94188..94385
FT                   /db_xref="GeneID:8736511"
FT                   /locus_tag="Acfer_0074"
FT   CDS_pept        94188..94385
FT                   /locus_tag="Acfer_0074"
FT                   /gene_family="HOG000044611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dps:DP2322 2-ketoglutarate oxidoreductase
FT                   subunit delta"
FT                   /db_xref="GI:284047459"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8736511"
FT                   /translation="MSKDITININEKLCKQCGICSALCPKQVLEQSYGSYPKVAHLDAC
FT                   IGCKLCALRCPDFAIEVEVK"
FT                   /protein_id="YP_003397798.1"
FT   misc_feature    <94206..94376
FT                   /note="RPB11 and RPB3 subunits of RNA polymerase; Region:
FT                   RNAP_RPB11_RPB3; cl11409"
FT                   /db_xref="CDD:175243"
FT                   /locus_tag="Acfer_0074"
FT   gene            94385..95530
FT                   /db_xref="GeneID:8736512"
FT                   /locus_tag="Acfer_0075"
FT   CDS_pept        94385..95530
FT                   /locus_tag="Acfer_0075"
FT                   /gene_family="HOG000223606" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /codon_start="1"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   nth:Nther_1482 2-oxoglutarate ferredoxin oxidoreductase,
FT                   alpha subunit"
FT                   /db_xref="GI:284047460"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="GeneID:8736512"
FT                   /translation="MAKVEKKFMEGNEAMTAGAIAAGARFFAGYPISPSSEVAKAAAKE
FT                   LPRHGGIYIQMEDELSSMAALLGASLAGKKAFTATSGPGFSLMQENLGLGIMSELPCVL
FT                   YNVQRSGPSTGAATKPAQGDLMQAKYGTHGDHSIIAISPSSVQDCYDLSITAFNLAEKY
FT                   RTPVIFLADEVVGHLRETLTIREPEPDEIINRKAPATKNQADFRPYDYSSTEVAPMVAV
FT                   GDRDLLMRTTGSTHDEKGEFCPSPENIDRVTHYLVDKIEKHVDDITITRKYQMDDADVV
FT                   LISFGCSVRSSLSAIEILRKKGVKAGLLQLVTVWPMPEKEIRAALQQAKIVIVPELNLG
FT                   QLAGEVRKYNDYGCKVLQANRTDGILLTPQQIVDVYEESEK"
FT                   /protein_id="YP_003397799.1"
FT   misc_feature    94472..95518
FT                   /note="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   alpha; Validated; Region: PRK08659"
FT                   /db_xref="CDD:169542"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    94472..94900
FT                   /note="Pyrimidine (PYR) binding domain of pyruvate
FT                   ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin
FT                   oxidoreductase alpha subunit (IOR-alpha), and related
FT                   proteins; Region: TPP_PYR_PFOR_IOR-alpha_like; cd07034"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    order(94472..94477,94481..94483,94499..94501,94544..94555,
FT                   94574..94579,94583..94591,94598..94600,94604..94606,
FT                   94655..94657,94664..94666)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    order(94475..94477,94559..94561)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    order(94481..94483,94493..94495,94544..94555,94574..94579,
FT                   94583..94591,94598..94600,94604..94606,94655..94657,
FT                   94664..94666,94676..94678,94715..94720,94769..94774)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    order(94481..94483,94709..94711)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Acfer_0075"
FT   misc_feature    95219..>95392
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="Acfer_0075"
FT   gene            95530..96345
FT                   /db_xref="GeneID:8736513"
FT                   /locus_tag="Acfer_0076"
FT   CDS_pept        95530..96345
FT                   /locus_tag="Acfer_0076"
FT                   /gene_family="HOG000007085" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: tte:TTE1341 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="GI:284047461"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="GeneID:8736513"
FT                   /translation="MKSYKDYMLFDKLPQTWCAGCSHGIVLQSIAAVMAELEVDKHDMA
FT                   LVSGIGCFGRVDDYLDINCMHVTHGRALAAATGVALGNPDLHVLVTMGDGDGTTIGGNH
FT                   LIHAARRNINVTAIISNNYNYGQTGGQYSGTTPTHSITQTSPYGHIEQNFDVCKLAIAA
FT                   GASYVGRATAYNPVMLRKLIKEGMQVKGFSLIEVMSACPTHYGKFNKLGAAAHMMQLMN
FT                   EQSVTVAQAAKMSEEELQGKIVVGCLKNAPRDDYYTDYKKIIDANRIEG"
FT                   /protein_id="YP_003397800.1"
FT   misc_feature    95578..96141
FT                   /note="TPP-binding module; OGFOR catalyzes the oxidative
FT                   decarboxylation of 2-oxo-acids, with ferredoxin acting as
FT                   an electron acceptor. In the TCA cycle, OGFOR catalyzes the
FT                   oxidative decarboxylation of 2-oxoglutarate to
FT                   succinyl-CoA. In the reductive...; Region: TPP_OGFOR;
FT                   cd03375"
FT                   /db_xref="CDD:73355"
FT                   /locus_tag="Acfer_0076"
FT   misc_feature    order(95734..95736,95806..95817,95893..95895,95899..95901)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:73355"
FT                   /locus_tag="Acfer_0076"
FT   gene            96348..96878
FT                   /db_xref="GeneID:8736514"
FT                   /locus_tag="Acfer_0077"
FT   CDS_pept        96348..96878
FT                   /locus_tag="Acfer_0077"
FT                   /gene_family="HOG000228812" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /codon_start="1"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase; KEGG:
FT                   mka:MK0730 2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   gamma"
FT                   /db_xref="GI:284047462"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="GeneID:8736514"
FT                   /translation="MKKEIVLSGVGGQGVVSVGEVMGLASLNEENINATMSASYGAEAR
FT                   GTFTKTDVVLSDGLVGYPNVAVPDLILCLAQVAYDRYVDKFTDDTLVFYDSDEVTPKEG
FT                   AKGTAIGHPFRKLAVELGSIQSANFIALGAMMKKTGLLKPESVEQGIAKRFAGKQKVID
FT                   SNRKAFEKGLTLE"
FT                   /protein_id="YP_003397801.1"
FT   misc_feature    96348..96872
FT                   /note="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   gamma; Validated; Region: PRK08537"
FT                   /db_xref="CDD:169478"
FT                   /locus_tag="Acfer_0077"
FT   misc_feature    96435..96866
FT                   /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   Region: POR; cl00546"
FT                   /db_xref="CDD:176928"
FT                   /locus_tag="Acfer_0077"
FT   gene            96914..98599
FT                   /db_xref="GeneID:8736515"
FT                   /locus_tag="Acfer_0078"
FT   CDS_pept        96914..98599
FT                   /locus_tag="Acfer_0078"
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: hor:Hore_10820 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="GI:284047463"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="GeneID:8736515"
FT                   /translation="MSGNELNYKNNRSGIMVNGVGRSGNRALLYSMGLEEDDFRKPIIG
FT                   IANSFSELVPGHIHLRDLARDVSDGILEAGGIPREFDTIALCDGLCQGHSGMRYSLPSR
FT                   EIIADSVEAVVEGNQLDAVVMLASCDKIVPGMILAAARMKIPAIIVTGGPMLAGNCDGY
FT                   TNICLSNLREFVGQYQVGKMSYEELRKMEMASLPTVGSCSMMGTANTMSCLAEVLGLTL
FT                   PRMGTSPAVSSEKRRLARASGKRIVAMVKEGITTQDILTRSALLDAVKAVMAMGASTNS
FT                   VLHLMAIAHEAHVDLTLEDFDRVSREVPYLCNLRPSGQYAVDVLHANGGVPAVLRAIED
FT                   KLDDHITVTGHTLKENIAAQPLVENDVIFPRSKPKNKEGGIAILKGNLAPDGAVVKASG
FT                   VKPNMHVFTGKARVFDSMEDSITAIEAGEIQPGTVIVLRYEGPKGGPGMREMFLVTALL
FT                   VGRGMDESTALVTDGRFSGSTRGPCIGHVSPEAAAGGPIGLIQDGDVIHIDIPNRSLTM
FT                   DVSDAELAERKKHFKPVVKATSPMLKKYAALVSSADKGAVLQVK"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /protein_id="YP_003397802.1"
FT   misc_feature    96938..98587
FT                   /note="Dehydratase family; Region: ILVD_EDD; cl00340"
FT                   /db_xref="CDD:174127"
FT                   /locus_tag="Acfer_0078"
FT   misc_feature    97010..98587
FT                   /note="dihydroxy-acid dehydratase; Region: ilvD; TIGR00110"
FT                   /db_xref="CDD:161713"
FT                   /locus_tag="Acfer_0078"
FT   gene            98658..99011
FT                   /db_xref="GeneID:8736516"
FT                   /locus_tag="Acfer_0079"
FT   CDS_pept        98658..99011
FT                   /locus_tag="Acfer_0079"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cce:Ccel_1672 2-dehydro-3-
FT                   deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate
FT                   aldolase"
FT                   /db_xref="GI:284047464"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:8736516"
FT                   /translation="MAEKITYKLKHVGINCENEKEAKQLVSLLCSLFDLEPGNENDTHI
FT                   FVSNMFEVMKDSTRGHHGHIALQTPDVELAMADLARKGISFKEETIRRDADGKVIFVYL
FT                   DGDIGGFSFHLTK"
FT                   /protein_id="YP_003397803.1"
FT   misc_feature    98688..98966
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cd06587"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Acfer_0079"
FT   misc_feature    order(98688..98690,98700..98702,98799..98801,98847..98849,
FT                   98958..98960)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Acfer_0079"
FT   misc_feature    order(98688..98690,98847..98849)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="Acfer_0079"
FT   gene            99170..100489
FT                   /db_xref="GeneID:8736517"
FT                   /locus_tag="Acfer_0080"
FT   CDS_pept        99170..100489
FT                   /locus_tag="Acfer_0080"
FT                   /gene_family="HOG000223272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02550"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   ere:EUBREC_3075 4-hydroxybutyrate coenzyme A transferase"
FT                   /db_xref="GI:284047465"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="GeneID:8736517"
FT                   /translation="MLEKYRNKVKTPAEAAKAVQSGDWVDFGFGNGFPELMDEALAARK
FT                   EELQDVKIRGGLVYRPIIHTIDCDPEMKHFQYYSWHLGGYERKMFTARRLHFVPMMLRL
FT                   LPEMYRDYLTVDVAVVPVSRPDANGYCGLGLASYCWKTIMKKARTVIFEINEHMPTLQG
FT                   VDGSHRVSLDEADIIVEGEHAPLCTSGYRTPSEADLQIARNVVAEIPNGATLSLGVGTI
FT                   PFTIAQILAQSDREDLGCHTGTISDAFLALYKAGKLTNDRKEDQTGLATWNLASGSQEL
FT                   YDWLQEKPELFYPAEVDYVHNPRIMEKISNYISINGGVQLDLMGQENAESIGTRQLSGV
FT                   GGQLDFLEGAFLSHGGAGYICIESSRVDKKGVRHSNIVPAIAAGSSIAGPRALIQNVAT
FT                   EFGVAHLTGLSLKERAQAMIAVAHPDFRAELQEYADKTFC"
FT                   /protein_id="YP_003397804.1"
FT   misc_feature    99170..99709
FT                   /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
FT                   Region: AcetylCoA_hydro; pfam02550"
FT                   /db_xref="CDD:111448"
FT                   /locus_tag="Acfer_0080"
FT   misc_feature    99176..100477
FT                   /note="Acetyl-CoA hydrolase [Energy production and
FT                   conversion]; Region: ACH1; COG0427"
FT                   /db_xref="CDD:30776"
FT                   /locus_tag="Acfer_0080"
FT   gene            100901..102214
FT                   /db_xref="GeneID:8736518"
FT                   /locus_tag="Acfer_0081"
FT   CDS_pept        100901..102214
FT                   /locus_tag="Acfer_0081"
FT                   /gene_family="HOG000017691" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_1789"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pjd:Pjdr2_1789 hypothetical protein"
FT                   /db_xref="GI:284047466"
FT                   /db_xref="GeneID:8736518"
FT                   /translation="MRITTRGGVVSQLLENVPLPRMFRARQTFPRPVLTPEEIPGVVRA
FT                   EMSREPFVSKLQPGMTIAITAGSRGIANVALITRSIVEFCKERGTRPFIVPAMGSHGGA
FT                   TAEGQREILAGYGITEEAMGCEIRSSMETVYLGMSQSGRPVYMDKNAYEADGIIVSCRL
FT                   KPHNAFRGKVESGPCKMMAVGLGKQKGAENVHADGMGKIAEHIPSMAQVFLEKAPILFA
FT                   IPSIENAYDETCKIVAIDTPHLIEEEAEWLKFAFANMPSLLVKEADVLVVDEIGKNYSG
FT                   TGVDPNIAGTFSTEYAHGGLKVQRTCFLDLSEASHGNALGIGLANCITARLFNKIDMDA
FT                   MYPNIVTNTVFKSGMIPFVVPTDKEAIQLCIRTTNGVDRDPAKVRVVRIPNTSHIGTVM
FT                   LSESYYEAVRAGKYPHLEALDEPAPLAFDDNGTLLTKI"
FT                   /protein_id="YP_003397805.1"
FT   misc_feature    100997..101398
FT                   /note="Uncharacterized conserved protein (DUF2088); Region:
FT                   DUF2088; pfam09861"
FT                   /db_xref="CDD:150523"
FT                   /locus_tag="Acfer_0081"
FT   gene            102232..103752
FT                   /db_xref="GeneID:8736519"
FT                   /locus_tag="Acfer_0082"
FT   CDS_pept        102232..103752
FT                   /locus_tag="Acfer_0082"
FT                   /gene_family="HOG000219063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03248"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.42"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU02510 D-galactarate dehydratase;
FT                   TIGRFAM: galactarate dehydratase; PFAM: D-galactarate
FT                   dehydratase/Altronate hydrolase domain protein; SAF domain
FT                   protein"
FT                   /db_xref="GI:284047467"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="GeneID:8736519"
FT                   /translation="MTAPLVIRVKEKDNVAIAVHDLPVGTEVLPGVVSLQPIPQAHKIA
FT                   LTDIPKGGEIIRYGVVLGYARDDIPKGSWINEHMLDLPESPALHDLPYATHIVPPEELP
FT                   DPVRTTWWGYRNKKGPAGTRNLLGVVTTVQCAAGVVNVAVDRIRRELLPKYPHVDDVVA
FT                   VNHPYGCGVAINAPMAKIPIRAVRNLIRHPNFGGEIMVIGLGCEKLTYDRLLEPEEINP
FT                   DNCLTLQDCHGHDAMMQAILDMAEKKLQRLEKRRREELPLSELVVGMQCGGSDAFSGLT
FT                   ANPSAGYAADMLVKGGGTVMFSEVTEVRDGVPMLAARCVNREVRDKLAAEMKWYDDYLA
FT                   EGGVDRDANPTPGNKKGGLANIVEKAMGSIAKSGTSPIVEVLSPAEKPTKHGLIYAATP
FT                   ASDIVCGPSQLASGIGLQVFMTGRGTPYGLAIAPVIKVCSRNEMKDNWFDMIDVSAGGV
FT                   ATGEATIPEVGTEIFNFILDVASGKKKPYSDQYGFHNDLCIFNPAPIT"
FT                   /product="galactarate dehydratase"
FT                   /protein_id="YP_003397806.1"
FT   misc_feature    102244..103749
FT                   /note="galactarate dehydratase; Region: galactar-dH20;
FT                   TIGR03248"
FT                   /db_xref="CDD:132292"
FT                   /locus_tag="Acfer_0082"
FT   misc_feature    102268..102471
FT                   /note="SAF domain; Region: SAF; cl00555"
FT                   /db_xref="CDD:174283"
FT                   /locus_tag="Acfer_0082"
FT   misc_feature    102553..103749
FT                   /note="SAF domain; Region: SAF; cl00555"
FT                   /db_xref="CDD:174283"
FT                   /locus_tag="Acfer_0082"
FT   gene            103871..105160
FT                   /db_xref="GeneID:8736520"
FT                   /locus_tag="Acfer_0083"
FT   CDS_pept        103871..105160
FT                   /locus_tag="Acfer_0083"
FT                   /gene_family="HOG000015038" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /codon_start="1"
FT                   /product="Na+/H+ antiporter NhaC-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Na+/H+ antiporter NhaC-like; KEGG: fnu:FN0978
FT                   Na+/H+ antiporter NhaC"
FT                   /db_xref="GI:284047468"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="GeneID:8736520"
FT                   /translation="MENLILGAFCLILFFFIFTGLPLLGALALGFLLFFGYGLYRGHSF
FT                   GAVLKMAWQGVLSVKTIFLVFILIGMLTAAWRASGTIGYIIALAVRFIRPSVFLLLTFW
FT                   LNCAVSFLLGTSFGTAATMGVITLSIGETLGISPLYSGGAILSGTYFGDRMSPVSTSAL
FT                   LVSVLTGTDIYRNIGNMARFTLVPFGLASLFYLVLGLWLPGIGQVGAMVSGLYDIYNFT
FT                   PWLVLPAVSILTLSFFRVSVKKNMAVSIVCALALCHFVQGWPWWHLLKILVTGYHLSDP
FT                   EYSGMLSGGGITSMVRVASIVCLSASFGGIFKGTGLLKGIESLFQHLKKKVGTYLSIIL
FT                   AALFTGMVSCNQTLSIVLTHQLCSSFVQDREQLALDLENTAVVISPLIPWSIACATILD
FT                   TTGAPHTSIALAVYLFLLPVWGLVKSRSAA"
FT                   /protein_id="YP_003397807.1"
FT   misc_feature    <103997..104362
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0083"
FT   misc_feature    104312..105121
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0083"
FT   gene            complement(105455..105898)
FT                   /db_xref="GeneID:8736521"
FT                   /locus_tag="Acfer_0084"
FT   CDS_pept        complement(105455..105898)
FT                   /locus_tag="Acfer_0084"
FT                   /gene_family="HOG000014143" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /codon_start="1"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /transl_table="11"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: cth:Cthe_0546
FT                   ferric uptake regulator family protein"
FT                   /db_xref="GI:284047469"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="GeneID:8736521"
FT                   /translation="MDKKGSPLDARQLIRRAGLKCTQARLQVLAMLLDQREVLSADEIY
FT                   QKLLQTGATLNFSTVYRILESFTEKKLTEKVLLPQSRKYGFLLYTLSHTHHLICLGCHK
FT                   VVNIDGCPLHGFEEDLAQKTHFEIVGHYLELYGYCEECRKKAL"
FT                   /protein_id="YP_003397808.1"
FT   misc_feature    complement(105482..105826)
FT                   /note="Ferric uptake regulator(Fur) and related
FT                   metalloregulatory proteins; typically iron-dependent,
FT                   DNA-binding repressors and activators; Region: Fur_like;
FT                   cd07153"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   misc_feature    complement(order(105578..105580,105611..105613,
FT                   105617..105619,105638..105640,105785..105787))
FT                   /note="metal binding site 2; metal-binding site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   misc_feature    complement(105689..105733)
FT                   /note="putative DNA binding helix; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   misc_feature    complement(order(105506..105508,105557..105559,
FT                   105614..105616,105620..105622))
FT                   /note="metal binding site 1; metal-binding site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   misc_feature    complement(order(105485..105511,105515..105523,
FT                   105548..105553,105599..105607))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   misc_feature    complement(order(105482..105484,105593..105595,
FT                   105602..105604))
FT                   /note="structural Zn2+ binding site; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Acfer_0084"
FT   gene            complement(105891..106703)
FT                   /db_xref="GeneID:8736522"
FT                   /locus_tag="Acfer_0085"
FT   CDS_pept        complement(105891..106703)
FT                   /locus_tag="Acfer_0085"
FT                   /gene_family="HOG000181429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; KEGG: cbl:CLK_0805
FT                   manganese/zinc/iron chelate ABC transporter permease"
FT                   /db_xref="GI:284047470"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:8736522"
FT                   /translation="MFEYAFMRNALAVSLLISLICPLIGTFLVLRRYSMIGDALSHASL
FT                   AGVATGLLFHANPILSAFCLTSFFGLLIEVLREKFRRYAELTLVIVLSLSVGIAITIIS
FT                   SGLVHANVDSFLFGSILTVSQGEVTTVAILTVISLLAIFGLFPQLVLLSFDEDGARILG
FT                   VKARAINYVFSILVAATISVSIRIVGILVISSLIALPVATALQLHQGFKKTMALAVLFS
FT                   FLDVMAGLVVSYYLGAAPGGITAIVSVVLLLLVLLFQSRSQKRQVRHG"
FT                   /protein_id="YP_003397809.1"
FT   misc_feature    complement(105960..106685)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Acfer_0085"
FT   misc_feature    complement(order(106071..106073,106092..106094,
FT                   106218..106226,106230..106247,106251..106256,
FT                   106260..106268,106272..106277,106611..106619,
FT                   106629..106631))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Acfer_0085"
FT   misc_feature    complement(order(105966..105971,105978..105980,
FT                   106125..106127,106353..106355,106362..106367,
FT                   106398..106400,106404..106409,106416..106418,
FT                   106425..106430,106437..106439,106440..106445,
FT                   106449..106451,106593..106595,106608..106610,
FT                   106614..106616))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Acfer_0085"
FT   misc_feature    complement(order(105987..105989,106002..106004,
FT                   106137..106139,106149..106151,106323..106325,
FT                   106398..106400))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Acfer_0085"
FT   gene            complement(106696..107370)
FT                   /db_xref="GeneID:8736523"
FT                   /locus_tag="Acfer_0086"
FT   CDS_pept        complement(106696..107370)
FT                   /locus_tag="Acfer_0086"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbf:CLI_1460 manganese/zinc/iron chelate ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="GI:284047471"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8736523"
FT                   /translation="MLQISHLSFAYEQGPYLLHDLSMEIHDGDYVAIVGENGSGKSTLV
FT                   KLILGLLTPSSGTISTTFRRPAYVPQPTDMVNKQFPITVREVLDYTRQVLRIKDREATD
FT                   RALAKMHIEPLQDHLIGALSGGQYQKVMIAKALLGKPDLMIFDEPSTGMDLKSQDDLYP
FT                   LIHQLNETQGITVVTVEHNLRYAAHNASSFFHVVRGQGHFCTPQEYIREYLAENGGDCA
FT                   HV"
FT                   /protein_id="YP_003397810.1"
FT   misc_feature    complement(106732..107370)
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="Acfer_0086"
FT   misc_feature    complement(106822..107364)
FT                   /note="ABC component of the metal-type transporters.  This
FT                   family includes transporters involved in the uptake of
FT                   various metallic cations such as iron, manganese, and zinc.
FT                   The ATPases of this group of transporters are very similar
FT                   to members of iron...; Region: ABC_Metallic_Cations;
FT                   cd03235"
FT                   /db_xref="CDD:72994"
FT                   /locus_tag="Acfer_0086"
FT   gene            107705..108607
FT                   /db_xref="GeneID:8736524"
FT                   /locus_tag="Acfer_0087"
FT   CDS_pept        107705..108607
FT                   /locus_tag="Acfer_0087"
FT                   /gene_family="HOG000180308" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ckr:CKR_2696 hypothetical protein"
FT                   /db_xref="GI:284047472"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="GeneID:8736524"
FT                   /translation="MKRIVLLLLAGLLTLFAGCGGKKAPAKTAEGRLPVVASFYAMKEI
FT                   TEAIGGDKVAVTTLIPEGTEPHEFQPTTRSMKDLSRARVLVLQGLGMEPWAEDMVKAAE
FT                   NPGLVQVTAARDVAPIANEDAEEIREHGQYDPHAWLSPSCAQVEAAAIVRGLSQADPDN
FT                   AAYYQANGEKFIGRLRQLEKTYKEKFQSVPRKDFVTGHAAFAYLCRDFGLEQNSVEGVF
FT                   ASGEPNARQLAKLVEYCREHQVNTIFTEAAVSPKTSQALAREVGAKVVPIHTLEGGEGE
FT                   GNYLQQMEENLARIYESLK"
FT                   /protein_id="YP_003397811.1"
FT   misc_feature    107792..108604
FT                   /note="Metal binding protein AcdA.  These proteins have
FT                   been shown to function in the ABC uptake of Zn2+ and Mn2+
FT                   and in competence for genetic transformation and adhesion.
FT                   The AcdA proteins belong to the TroA superfamily of helical
FT                   backbone metal receptor...; Region: AdcA; cd01017"
FT                   /db_xref="CDD:29736"
FT                   /locus_tag="Acfer_0087"
FT   misc_feature    order(107903..107905,108113..108115,108305..108307,
FT                   108530..108532)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29736"
FT                   /locus_tag="Acfer_0087"
FT   gene            108990..109481
FT                   /db_xref="GeneID:8736525"
FT                   /locus_tag="Acfer_0088"
FT   CDS_pept        108990..109481
FT                   /locus_tag="Acfer_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047473"
FT                   /db_xref="GeneID:8736525"
FT                   /translation="MIHHDGKIQDSGSGSGVLCGRQHGGASVVFCDPGSCSRSGGGKSV
FT                   GCTSFGQPGWMSLLQPEWTALERWTTGPGRLLEPGPTAPLLGRRRPGTGAAELKKRGVK
FT                   EFTLPVAGRESQVAGLDVQVVCLSSIFLYDDETQSDETCIASFSGCTSKPATHGSRPVT
FT                   "
FT                   /protein_id="YP_003397812.1"
FT   gene            109543..110259
FT                   /db_xref="GeneID:8736526"
FT                   /locus_tag="Acfer_0089"
FT   CDS_pept        109543..110259
FT                   /locus_tag="Acfer_0089"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: cag:Cagg_2709 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="GI:284047474"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:8736526"
FT                   /translation="MDNYSVLLVDDDPKLLDLLVNYFTKEQFTVLAARDGEEALRIFRK
FT                   EQPQLLVLDLMLPKIDGRDVCRTIRQDSTVPIIMLTARDAEFDRLMGLELGADDYVTKP
FT                   FSMRELVARVRALLRRTYGAYGQQKEGAPETVIRAGTLELDLDRHILRRKEEGDGWKPI
FT                   ELTPIEFNLLEVLMKSPGHVYNRLQLMENSHGFAFDGYERTIDAHIRNLRRKIEPDTKN
FT                   PRYILTVYGIGYKFGG"
FT                   /protein_id="YP_003397813.1"
FT   misc_feature    109603..109869
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    109606..110250
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    order(109702..109704,109726..109728,109783..109785,
FT                   109840..109842,109849..109854)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    109702..109704
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    order(109711..109716,109720..109728)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    109849..109857
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    109951..110250
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0089"
FT   misc_feature    order(110038..110040,110095..110100,110152..110154,
FT                   110161..110163,110185..110190,110224..110226,
FT                   110239..110241)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0089"
FT   gene            110263..111429
FT                   /db_xref="GeneID:8736527"
FT                   /locus_tag="Acfer_0090"
FT   CDS_pept        110263..111429
FT                   /locus_tag="Acfer_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   chy:CHY_2566 sensor histidine kinase"
FT                   /db_xref="GI:284047475"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:8736527"
FT                   /translation="MHFHSVRNKMMLSTFLLILVCALIVIAICNQQMETHFFQYLQDPS
FT                   ALAGQQGGENCGQGLGMGRGMMGGGMGMGGMRRRMMMGAAERTFVESYHKSLWWIGFLF
FT                   AGIGLVVSYFLSGNITRPLRQLSQAAEKIRQGELKQEVPVETGDEVGQLASVFNQMSAE
FT                   LAANESNRQELLANIAHELKTPLAVLQGHLESMLDGVEQPEPDKLFSMQEEVMRLTRLV
FT                   GDLRDLSLAQVHQLELHLQPVDLGEKTERSAEMLEPLLEEKKLHFKKELAPDLPVRQLD
FT                   PDRMNQILYNLITNAIRYTTPGTAILLKTEGAGEKVRLTIADEGPGIPPEDLPHVFEQF
FT                   YRGEKSRNRASGGSGIGLSLAKSFVEAQGGHIEARNRPQGGAEFVVEV"
FT                   /protein_id="YP_003397814.1"
FT   misc_feature    110617..110754
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    order(110617..110622,110629..110634,110638..110643,
FT                   110650..110655,110659..110661,110707..110712,
FT                   110716..110721,110728..110733,110737..110742,
FT                   110749..110754)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    110764..110949
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    order(110782..110784,110794..110796,110806..110808,
FT                   110815..110817,110827..110829,110836..110838,
FT                   110887..110889,110893..110895,110902..110904,
FT                   110914..110916,110923..110925,110935..110937)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    110800..110802
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    111121..111426
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    order(111133..111135,111145..111147,111154..111156,
FT                   111223..111225,111229..111231,111235..111237,
FT                   111241..111246,111325..111336,111382..111384,
FT                   111388..111390,111403..111408,111412..111414)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    111145..111147
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0090"
FT   misc_feature    order(111235..111237,111241..111243,111325..111327,
FT                   111331..111333)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0090"
FT   gene            111770..112273
FT                   /db_xref="GeneID:8736528"
FT                   /locus_tag="Acfer_0091"
FT   CDS_pept        111770..112273
FT                   /locus_tag="Acfer_0091"
FT                   /gene_family="HOG000261949" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CCV52592_0992"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ccv:CCV52592_0992 hypothetical protein"
FT                   /db_xref="GI:284047476"
FT                   /db_xref="GeneID:8736528"
FT                   /translation="MVMTNYMDLLAANQPWNLILFMVIPVVLAESLVATEFYTTYYNGK
FT                   AAGWKAWNHRLGIAAGVYFALVVLYLLVNVVPGIHWKGWADQLAIVAYLLGIVPLGAIA
FT                   LMEMGVTGKHLTEQQRTLRHFGLLIGFLVVSHVAMVFGMVDPTITGWQPMPAQMHQMDH
FT                   MGHM"
FT                   /protein_id="YP_003397815.1"
FT   gene            complement(112316..113140)
FT                   /db_xref="GeneID:8736529"
FT                   /locus_tag="Acfer_0092"
FT   CDS_pept        complement(112316..113140)
FT                   /locus_tag="Acfer_0092"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: pen:PSEEN2360
FT                   hypothetical protein"
FT                   /db_xref="GI:284047477"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="GeneID:8736529"
FT                   /translation="MILTAMLALPLGALSAQAAPVKGRILVIASSEGTLELANHTRMST
FT                   GFFLNELAVPTEYLAQKGWEIVLATPEGKDPIMDQGSNDKKFFQDKETERARAEAFVNG
FT                   LKPISFQQAIQGGLDRYDALFIPGGHAPMGSLMENQDLGTILKDFHAKEKPTALICHGP
FT                   AAALAALPDPAGYRKALVDRDVRSVLALGKGWIYEGYAMTALSDAEEWPGEVAKGTEMP
FT                   FHLEQALQLAGGKIQVQGINQSHVVKDRELITGQNPASDLELAKALEKALKK"
FT                   /protein_id="YP_003397816.1"
FT   misc_feature    complement(112361..113068)
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in proteins similar to Escherichia coli Hsp31
FT                   protein; Region: GATase1_Hsp31_like; cd03141"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Acfer_0092"
FT   misc_feature    complement(order(112511..112513,112658..112663))
FT                   /note="potential catalytic triad; other site"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Acfer_0092"
FT   misc_feature    complement(112661..112663)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153235"
FT                   /locus_tag="Acfer_0092"
FT   gene            complement(113262..113585)
FT                   /db_xref="GeneID:8736530"
FT                   /locus_tag="Acfer_0093"
FT   CDS_pept        complement(113262..113585)
FT                   /locus_tag="Acfer_0093"
FT                   /gene_family="HOG000293547" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: cac:CAC1483
FT                   transcriptional regulator"
FT                   /db_xref="GI:284047478"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:8736530"
FT                   /translation="MNEKKYNCPVEAALSQLGGKYKAIILYYLMTESVLRFSQLQRHIP
FT                   RATAKMLTQQLRELEGDGLIHRTVYPVVPPKTEYTLTDRGESLRPIIMAICNWGREYMA
FT                   GTF"
FT                   /protein_id="YP_003397817.1"
FT   misc_feature    complement(113274..113585)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0093"
FT   gene            113718..114284
FT                   /db_xref="GeneID:8736531"
FT                   /locus_tag="Acfer_0094"
FT   CDS_pept        113718..114284
FT                   /locus_tag="Acfer_0094"
FT                   /gene_family="HOG000115784" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /codon_start="1"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: bfs:BF2126 putative flavoredoxin"
FT                   /db_xref="GI:284047479"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="GeneID:8736531"
FT                   /translation="MQKDIGAVMGLYPTPVTIVGTVAEGRVNWLPVAHVGVVEHTRFLI
FT                   SVDKAHEFSVRGIETNGTVSVSLVNRDILAAADYCGLHKGAQEDKSQVFPHHFDEVEGA
FT                   PIPDNAPLVMTCRVIRKVEVGQFNNYILEPVHTYVEERYLNERNKPDYAKMRPILFEFR
FT                   NALYLETGDVAGRCWQIGREFQVRR"
FT                   /protein_id="YP_003397818.1"
FT   misc_feature    113742..114140
FT                   /note="Flavin Reductases; Region: FlaRed; cl00801"
FT                   /db_xref="CDD:154006"
FT                   /locus_tag="Acfer_0094"
FT   gene            complement(114393..115250)
FT                   /db_xref="GeneID:8736532"
FT                   /locus_tag="Acfer_0095"
FT   CDS_pept        complement(114393..115250)
FT                   /locus_tag="Acfer_0095"
FT                   /gene_family="HOG000279078" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbe:BBR47_11810 transcriptional regulator"
FT                   /db_xref="GI:284047480"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736532"
FT                   /translation="MDNKDILLLKTLYEEKNITHTAKRLFLSQPALTDRLKRLEAEFGC
FT                   TLFLRQPRGIQFTSEGELLYRFFLQMESSYQKIRDSLSDARIHPAGTLSIACSNVFAKY
FT                   HMPRILTQFRKIYPRIEIHMKSGFSHDRYRDFLEGKYHICIVRGDHNWNEEKRLLWQDP
FT                   LCAFSREPLNMDLLPSYPYIHYVTDPLLQNVLDDWWYAHYRKPPLTIIETDAMDTCLKM
FT                   VQEGLGFTLLSRSCGQDTPRITPTVLTTLEGKPLLRETWMFYRKNYRHLASVRAFVEFM
FT                   EEKY"
FT                   /protein_id="YP_003397819.1"
FT   misc_feature    complement(114402..115250)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0095"
FT   misc_feature    complement(115065..115241)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0095"
FT   misc_feature    complement(114408..114977)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0095"
FT   misc_feature    complement(order(114576..114581,114585..114590,
FT                   114606..114623,114873..114893,114897..114899,
FT                   114909..114911,114918..114923,114927..114932))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0095"
FT   gene            115609..117897
FT                   /db_xref="GeneID:8736533"
FT                   /locus_tag="Acfer_0096"
FT   CDS_pept        115609..117897
FT                   /locus_tag="Acfer_0096"
FT                   /gene_family="HOG000118046" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00330"
FT                   /codon_start="1"
FT                   /product="aconitate hydratase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: aconitate hydratase domain protein; KEGG:
FT                   hor:Hore_21050 aconitate hydratase"
FT                   /db_xref="GI:284047481"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="GeneID:8736533"
FT                   /translation="MVELIHEGVYYRDGQLLTEAELAAQGVKADRDGGTRKTLAYQVLK
FT                   AHQQGEGMDDLHLKFDALTSHDITYVGIIQTAIASGLDHFPVPYILTNCHNSLAAVGGT
FT                   INEDDHVFGLSAVKRFGGQYVPPHMAVIHEYMREKMAGGGKMILGSDSHTRYGAFGTMA
FT                   IGEGGPELVKQLLGHTYDVQRPQVIAIYLKGKPRHGVGPQDVALAIEKAVFKNGFVKNK
FT                   VMEFMGPGIAGLSMDFRNGIDVMTTETTCLTTIWSTDTTVKDYLELHRRPEAYREMKPG
FT                   DLAYYDGAVVVDLDKVESMIAMPFHPSHVYTIKELNEGGRDLLEEIEKQAVDMLDNKEL
FT                   SLGLADKYYDGKMHCDQGLIAGCSGGLYENLVAAAHILKGRSIGNERFAFSVYPSSHPI
FT                   YMELMRNGALADLMDAGAVVRSAFCGPCFGAGDTPNNKGFSVRHTTRNFPNREGSKPGK
FT                   GQIASVALMDARSVAATAANHGALTPATEVEYDDSVPAYHYDSLPYDHKVFDGIGQPDK
FT                   KEELVYGPSIKPWPSIEKLNENVLLKVAAWIDDPVTTTDELIPSGETSSYRSDPYALSE
FT                   FALSRKVPEYVGRAKAVRTLEKARQEGENCEELNNMYDSVKNALGLQESADQMKKNTSV
FT                   GSVVYANKPGDGSAREQAASCQRVLGGAANIALEYATKRYRSNVMNWGMLPFLTSYDDS
FT                   RKLAVGDLVYVPNVREILLGDTDEYKGFIVRDGKKVGEIALHLGAVEPSQKEILAAGCL
FT                   INYYAGSKK"
FT                   /protein_id="YP_003397820.1"
FT   misc_feature    115609..117882
FT                   /note="hypothetical protein; Provisional; Region: PRK11413"
FT                   /db_xref="CDD:171103"
FT                   /locus_tag="Acfer_0096"
FT   misc_feature    115840..117054
FT                   /note="Aconitase catalytic domain; Aconitase catalyzes the
FT                   reversible isomerization of citrate and isocitrate as part
FT                   of the TCA cycle; Region: Aconitase; cl00285"
FT                   /db_xref="CDD:174089"
FT                   /locus_tag="Acfer_0096"
FT   misc_feature    order(116059..116064,116890..116892,116944..116946,
FT                   116959..116961)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:153129"
FT                   /locus_tag="Acfer_0096"
FT   misc_feature    order(116065..116067,116695..116697,116878..116880,
FT                   116887..116892,116941..116943)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:153129"
FT                   /locus_tag="Acfer_0096"
FT   misc_feature    117268..117729
FT                   /note="Aconitase swivel domain. Aconitase (aconitate
FT                   hydratase) catalyzes the reversible isomerization of
FT                   citrate and isocitrate as part of the TCA cycle. This is
FT                   the aconitase swivel domain, which undergoes swivelling
FT                   conformational change in the enzyme...; Region:
FT                   Aconitase_swivel; cl00215"
FT                   /db_xref="CDD:174039"
FT                   /locus_tag="Acfer_0096"
FT   misc_feature    117550..117558
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73200"
FT                   /locus_tag="Acfer_0096"
FT   gene            117980..119302
FT                   /db_xref="GeneID:8736534"
FT                   /locus_tag="Acfer_0097"
FT   CDS_pept        117980..119302
FT                   /locus_tag="Acfer_0097"
FT                   /gene_family="HOG000241948" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /codon_start="1"
FT                   /product="Citrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate transporter; KEGG: asu:Asuc_1303
FT                   citrate transporter"
FT                   /db_xref="GI:284047482"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="GeneID:8736534"
FT                   /translation="MLLGIAGFVLIGLVVYCLISSKMNAIPIFVAFPIIIALLCGFAPA
FT                   EVFAFIKKGVGTTMSTAILFLFSIVYFALMNDVGMFDPLMNFLAKKAGNNIVLVTIATG
FT                   IIATIAHLDGTTAGTCLITVPAMLPLYKKLHIRPVVLCCIISAAISIMNLTPWGGPVAR
FT                   TAIILKTDASILWHELLPLQGVGILIVLGFCVYMGLLEKKRGAGLNPTGKAAELTEDMS
FT                   MAGNDAPADPSLKRPKLVWINWLVTLVVILLMCFTKIPLYGAFMIGLAAALIINFRSSK
FT                   EQANAVKRHASAALLTPMILLTTGIFLGILNGTGMMKSMANILINIMPNALGPKLATVM
FT                   GCLSVPFGMMLGTDSFFFGFMPLCIGVAEKFGVAAHDIAMSMLIGKDFCIMVTPHNATT
FT                   WLLIGMAGVSLKDQLKFSAPYLWILSIITVFAAGILGVFQM"
FT                   /protein_id="YP_003397821.1"
FT   misc_feature    117983..119293
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0097"
FT   misc_feature    118094..119134
FT                   /note="Citrate transporter; Region: CitMHS; pfam03600"
FT                   /db_xref="CDD:146307"
FT                   /locus_tag="Acfer_0097"
FT   gene            119931..120605
FT                   /db_xref="GeneID:8736535"
FT                   /locus_tag="Acfer_0098"
FT   CDS_pept        119931..120605
FT                   /locus_tag="Acfer_0098"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bcg:BCG9842_B2033 DNA-binding response
FT                   regulator"
FT                   /db_xref="GI:284047483"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:8736535"
FT                   /translation="MKILVVEDEPTLNKIIAKRLKIEAYSVDCAFNGKEALDYLDAAEY
FT                   DLLIVDIMMPEMDGLTLVKKLRDGGSRVPVLFLTALDSTQDKVTGLDSGGDDYLVKPFE
FT                   FDELLARIRSLLRRSNAQQTARTRLTLADLTLDTRTHQVTRGGQEIALTPKEFSVLDYL
FT                   LRNQGTVLSREQILEHAWDFSYEGYSNMVDVYIKTLRKKIDRDFEPKLLHTVRGTGYVL
FT                   KV"
FT                   /protein_id="YP_003397822.1"
FT   misc_feature    119931..120599
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    119940..120251
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    order(119949..119954,120081..120083,120105..120107,
FT                   120165..120167,120222..120224,120231..120236)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    120081..120083
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    order(120090..120095,120099..120107)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    120231..120239
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    120351..120596
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0098"
FT   misc_feature    order(120387..120389,120444..120449,120501..120503,
FT                   120510..120512,120534..120539,120570..120572,
FT                   120585..120587)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0098"
FT   gene            120589..122016
FT                   /db_xref="GeneID:8736536"
FT                   /locus_tag="Acfer_0099"
FT   CDS_pept        120589..122016
FT                   /locus_tag="Acfer_0099"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   cco:CCC13826_1970 hypothetical protein"
FT                   /db_xref="GI:284047484"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:8736536"
FT                   /translation="MCSKCRMVLGRRLQQGWKRLKNLPVSLRVTLWYTLFLSIILVLFT
FT                   GVILKMGVDYEKRAAGRTLIKAVEKAGDRYTGKKGKFRSFDDNVYLSLQTHRGELLEGA
FT                   EPEEAPRGMQPVFGRGPQALVIQGVPYHYFDLPLRPDEQKIRAGTFRGPGPFIRGYLAD
FT                   TVYSRYYRVLLLGALIALPLFLVLVTLGGYRIIKRSFAPVQAISEAARAIGETGDLSQR
FT                   IPLDDSRDEIHQMGRTFNWMLGQIEELLEREKRFTSDVSHELRTPTAVIMAESEFGKDY
FT                   TDNLEEAREEFRHIFQQSRRMSRLINQLLELSRLGNRKHLDLVPVDLSRLVQETLEDYQ
FT                   KLPQAGNFQWKTAVQPDLQVLGDEALLTRILSNYLDNALKFTRSRIGVRLESREGGVRL
FT                   SVTDDGNGLLPEELEKIWDRLYQADPSRNKKQNMGLGLGLSFVAAGARLMQGRAGAESQ
FT                   VGKGSTFFLQLPAARKP"
FT                   /protein_id="YP_003397823.1"
FT   misc_feature    121189..121332
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    order(121195..121200,121204..121209,121216..121221,
FT                   121225..121227,121279..121284,121288..121293,
FT                   121300..121305,121309..121314,121321..121326)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    121336..121530
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    order(121354..121356,121366..121368,121378..121380,
FT                   121387..121389,121399..121401,121408..121410,
FT                   121459..121461,121471..121473,121480..121482,
FT                   121492..121494,121501..121503,121513..121515)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    121372..121374
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    121687..121995
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    order(121705..121707,121717..121719,121726..121728,
FT                   121789..121791,121795..121797,121801..121803,
FT                   121807..121812,121894..121905,121951..121953,
FT                   121957..121959,121972..121977,121981..121983)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    121717..121719
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0099"
FT   misc_feature    order(121801..121803,121807..121809,121894..121896,
FT                   121900..121902)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0099"
FT   gene            122143..122841
FT                   /db_xref="GeneID:8736537"
FT                   /locus_tag="Acfer_0100"
FT   CDS_pept        122143..122841
FT                   /locus_tag="Acfer_0100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:284047485"
FT                   /db_xref="GeneID:8736537"
FT                   /translation="MDKEKMEQGKAWLKGAVHWGRKQITPQRLKKGAGCLLVLAVAAGG
FT                   GKFALHRARAEARSQEAQARTKMLQNLAAQKNLSLASIDAVKENIASTLETDVSNITFQ
FT                   SITLDDRKPGEGKPWDPKPGKKERKENLRGTKEENSRQKPEKQPEGRLPGQPEERKEGP
FT                   DGRTGATPRKLEGSRPEMAKAAPAGIFHGVYLARCEKDGMSYQFLVDAQNGQVLHGRVH
FT                   KLNPIQQLLG"
FT                   /protein_id="YP_003397824.1"
FT   gene            122856..123179
FT                   /db_xref="GeneID:8736538"
FT                   /locus_tag="Acfer_0101"
FT   CDS_pept        122856..123179
FT                   /locus_tag="Acfer_0101"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: axoneme-associated protein mst101(1)"
FT                   /db_xref="GI:284047486"
FT                   /db_xref="GeneID:8736538"
FT                   /translation="MTKIVTYAMAKPYESMIHRFKKITSLFLLGITLVLGGSALMSSKA
FT                   EAATPPTPREVHQVRLERHKKAVQHRKEVRKERAEARKHRAEERKKHAEIRKEHRQERA
FT                   HRW"
FT                   /protein_id="YP_003397825.1"
FT   gene            complement(123221..124063)
FT                   /db_xref="GeneID:8736539"
FT                   /locus_tag="Acfer_0102"
FT   CDS_pept        complement(123221..124063)
FT                   /locus_tag="Acfer_0102"
FT                   /gene_family="HOG000227597" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ele:Elen_1694 radical SAM domain protein"
FT                   /db_xref="GI:284047487"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="GeneID:8736539"
FT                   /translation="MTAPEKILTCSLCPHRCRLAPGQTGFCRARTNREGTICPDNYGFL
FT                   TSLALDPIEKKPLRRFHPGSQILSLGSWGCSFRCPFCQNASIAQAGAETARLRLDPEQL
FT                   QALALESREKAGSIGVAFTYNEPLVGYEYVRDCARLLKSHGLATVLVTNGFLCREPWEK
FT                   LLPLVDAANIDLKGFTPEFYRWVGGDLDTVKTNIRLAVEAGCHVEVTTLVIPGKNDGEE
FT                   DMKKEAQWLASLSPELPLHISRYFPRWHLDLPPTPVETVYHLAALARKWLKFVYEGNC"
FT                   /protein_id="YP_003397826.1"
FT   misc_feature    complement(123224..123976)
FT                   /note="Pyruvate-formate lyase-activating enzyme
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: PflA; COG1180"
FT                   /db_xref="CDD:31373"
FT                   /locus_tag="Acfer_0102"
FT   misc_feature    complement(123320..123844)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0102"
FT   misc_feature    complement(order(123329..123334,123428..123430,
FT                   123542..123544,123605..123613,123686..123691,
FT                   123695..123697,123815..123823,123827..123829,
FT                   123833..123835,123839..123841))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0102"
FT   gene            complement(124060..125457)
FT                   /db_xref="GeneID:8736540"
FT                   /locus_tag="Acfer_0103"
FT   CDS_pept        complement(124060..125457)
FT                   /locus_tag="Acfer_0103"
FT                   /gene_family="HOG000245466" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /codon_start="1"
FT                   /product="AMMECR1 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: AMMECR1 domain protein; Extradiol ring-
FT                   cleavage dioxygenase class III protein subunit B; KEGG:
FT                   shi:Shel_17380 hypothetical protein"
FT                   /db_xref="GI:284047488"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="GeneID:8736540"
FT                   /translation="MTILASFAVPHPPIILPEVGQGEEEKIRKTIAAYDTVMEKAAGLQ
FT                   PDTLIITSPHGEMYMDYFHIAPGPTARGDFAQFRAPQVELSVRYDRDLASLIAEEAREA
FT                   GIPAGFEGERDPALDHGTMIPLYFYRKYGSLDKVKVVRIGLSGLGPDVHYLFGRCIREA
FT                   VEKLGRRAVFIASGDLSHKLKEDGPYGYVPEGPVFDRQCTEALGQGDFFRLLTLDHSLC
FT                   TRAAECGLRSFWIMAGAWDGMNVKARLLSYEGPFGVGYGVAAFLPGAPDPGRKFLSPLL
FT                   AAEKKQREERVAREDPYVKLARLAVETYVKDREIPSLPEGLPPEMLSARAGAFVSLHLR
FT                   DQLRGCIGTFLPTRNNLAEEILRNGISAATRDPRFPPVRPEELPYLEYNVDVLTTPEPV
FT                   SGPEQLDPRKYGVIVKSAQDERRGLLLPDLDGVDTVGDQIAIARQKGNIAVTEPVQLFR
FT                   FQVVRHR"
FT                   /protein_id="YP_003397827.1"
FT   misc_feature    complement(124063..125448)
FT                   /note="hypothetical protein; Provisional; Region: PRK03881"
FT                   /db_xref="CDD:167627"
FT                   /locus_tag="Acfer_0103"
FT   misc_feature    complement(124663..125436)
FT                   /note="The N-terminal domain, an extradiol dioxygenase
FT                   class III subunit B-like domain, of unknown proteins
FT                   containing a C-terminal AMMECR1 domain; Region:
FT                   ED_3B_N_AMMECR1; cd07951"
FT                   /db_xref="CDD:153388"
FT                   /locus_tag="Acfer_0103"
FT   misc_feature    complement(124063..124566)
FT                   /note="AMMECR1; Region: AMMECR1; cl00911"
FT                   /db_xref="CDD:174453"
FT                   /locus_tag="Acfer_0103"
FT   gene            complement(125520..126167)
FT                   /db_xref="GeneID:8736541"
FT                   /locus_tag="Acfer_0104"
FT   CDS_pept        complement(125520..126167)
FT                   /locus_tag="Acfer_0104"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   dge:Dgeo_1556 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="GI:284047489"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:8736541"
FT                   /translation="MEPAKTFDELKKQLEDCAACPLRKDCQAPVGWFGNLESPLMIVGE
FT                   GPGGVEDDYGCPLIGPSGQLLDKALWSVRITRDRIYTTNVIKCRPRGNRTPTVEEGSFC
FT                   ARLWLEQEIRLLRPKVILALGSVALRYFKGPEARITRERGQWFTTGEGIPCLATFHPSY
FT                   LLRLTGQAQIAAKWDVFHDLEAVKAKVEEQCPGYCWNSGAPVHLFALFRKRS"
FT                   /protein_id="YP_003397828.1"
FT   misc_feature    complement(125592..126167)
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:174234"
FT                   /locus_tag="Acfer_0104"
FT   gene            complement(126437..126961)
FT                   /db_xref="GeneID:8736542"
FT                   /locus_tag="Acfer_0105"
FT   CDS_pept        complement(126437..126961)
FT                   /locus_tag="Acfer_0105"
FT                   /gene_family="HOG000081143" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07456"
FT                   /codon_start="1"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /transl_table="11"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: acl:ACL_0056 integral membrane protein"
FT                   /db_xref="GI:284047490"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="GeneID:8736542"
FT                   /translation="MPSSDKLTIHEMTQLGVLLAAAIALRLAETSLAWLLPLPGAHLGL
FT                   ANTVTIIVLYLYGPGKTALFLTCRILLTGLLFTGLLTPGFLIGLGGAALSFAGMALARK
FT                   HQWFSTVGVGLLGAFLHNCGQILVAVAIMRTPALFSYLPVLIAIGIPTGLFTGFLAGFF
FT                   LERMKEKDSAA"
FT                   /protein_id="YP_003397829.1"
FT   misc_feature    complement(126509..126823)
FT                   /note="Heptaprenyl diphosphate synthase component I;
FT                   Region: Hpre_diP_synt_I; cl01973"
FT                   /db_xref="CDD:154687"
FT                   /locus_tag="Acfer_0105"
FT   gene            complement(126945..127322)
FT                   /db_xref="GeneID:8736543"
FT                   /locus_tag="Acfer_0106"
FT   CDS_pept        complement(126945..127322)
FT                   /locus_tag="Acfer_0106"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07009"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1312"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   tte:TTE2485 hypothetical protein"
FT                   /db_xref="GI:284047491"
FT                   /db_xref="InterPro:IPR010739"
FT                   /db_xref="GeneID:8736543"
FT                   /translation="MRKNDFWLILGLALLALGSWFLFRSRTSDRDKVLVVRQDQQVIQR
FT                   IELKKVTSETKLMVPTEHGEVVIVYDREGGRVLSSPCPDQVCVRQGKITQSGQTIACVP
FT                   EKVLVTLTTAAKENDHDAILR"
FT                   /protein_id="YP_003397830.1"
FT   misc_feature    complement(126993..>127181)
FT                   /note="Protein of unknown function (DUF1312); Region:
FT                   DUF1312; cl02206"
FT                   /db_xref="CDD:154798"
FT                   /locus_tag="Acfer_0106"
FT   gene            complement(127332..128333)
FT                   /db_xref="GeneID:8736544"
FT                   /locus_tag="Acfer_0107"
FT   CDS_pept        complement(127332..128333)
FT                   /locus_tag="Acfer_0107"
FT                   /gene_family="HOG000080809" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /codon_start="1"
FT                   /product="ApbE family lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: swo:Swol_1956
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="GI:284047492"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="GeneID:8736544"
FT                   /translation="MKKLLASLLVFSSLTCAGCFFQTEKQEDTRFMMDTIVTITTTGDS
FT                   KKDLAAATSDAFQLFQTIANQTDPYTEQGPEDLYAVNQSAGQGPHKASPYLMDILSKVQ
FT                   PMGNRDLDLSLGPVIQVWNAHKEARTVPGQEEIARALARTGPGTYTVDTAANTVTLAPG
FT                   AQLDLGAVAKGYAVEQTADLLSRDKRVKTALINAGGNIKVLGTKEDGSPWKIGVQDPRN
FT                   PQRIIGTLAVKDGTAIATSGDYQRYYEVDGKRYHHILDPHTGWPAWHARSVTVVTRSAF
FT                   WADYYSTLLFVLPEDKAMALVEDNPNLEMLYVDQDGKTFLSSGLKAIYTPEK"
FT                   /protein_id="YP_003397831.1"
FT   misc_feature    complement(127395..128105)
FT                   /note="ApbE family; Region: ApbE; cl00643"
FT                   /db_xref="CDD:174326"
FT                   /locus_tag="Acfer_0107"
FT   gene            complement(128346..129263)
FT                   /db_xref="GeneID:8736545"
FT                   /locus_tag="Acfer_0108"
FT   CDS_pept        complement(128346..129263)
FT                   /locus_tag="Acfer_0108"
FT                   /gene_family="HOG000015548" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04060"
FT                   /codon_start="1"
FT                   /product="Fe-S cluster domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Fe-S cluster domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: bvu:BVU_3890
FT                   ferredoxin"
FT                   /db_xref="GI:284047493"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8736545"
FT                   /translation="MITTAVILVAVLGGVFGLVLATASKKFAVEEDPRIGEITNLLPGA
FT                   NCGGCGFAGCGALADAIVSGQEKDATKCVVCSAENKKAIAAVMGVESNDDENAVRSIPR
FT                   LHCNGCTANRTPIANREGIKNCYVKAANAGGPGQCNFGCFGDGACVDACNFGALKIGEN
FT                   GLPEFDYNKCVSCGACSKACPQLLIEMIPADKKVLVQCNNREKGKAAMTDCKVSCISCG
FT                   ICVKTCPKQAITLEDTPNGSIPVIDYDKCVGCGLCTMKCPRKCLVKINPVTGTPEAPAK
FT                   PEPTGCACCAMADQCPSAQAQKQK"
FT                   /protein_id="YP_003397832.1"
FT   misc_feature    complement(128400..129194)
FT                   /note="ferredoxin; Validated; Region: PRK07118"
FT                   /db_xref="CDD:168828"
FT                   /locus_tag="Acfer_0108"
FT   misc_feature    complement(<128571..>128753)
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl00255"
FT                   /db_xref="CDD:174071"
FT                   /locus_tag="Acfer_0108"
FT   misc_feature    complement(<128472..>128612)
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl00255"
FT                   /db_xref="CDD:174071"
FT                   /locus_tag="Acfer_0108"
FT   gene            complement(129281..129856)
FT                   /db_xref="GeneID:8736546"
FT                   /locus_tag="Acfer_0109"
FT   CDS_pept        complement(129281..129856)
FT                   /locus_tag="Acfer_0109"
FT                   /gene_family="HOG000279324" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /codon_start="1"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   tpd:Teth39_2120 electron transport complex, RnfABCDGE type,
FT                   A subunit"
FT                   /db_xref="GI:284047494"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="GeneID:8736546"
FT                   /translation="MHSTFGILFSSIFVSNIILSRFLGMCSFLGVSKNFKNSVGMSAAV
FT                   SFVMLLSTMLSYACYHLLLVPYHLEYLKTLVFILAIATLVQLVEMFMKKAMPSLHKAMG
FT                   IYLPLITTNCAILGIALINVESNYSFLDSCVNSIGTSIGYTMAILLFSCIRERLDEKAL
FT                   PKCLQNLPIALITASCMSISMMGMSGIH"
FT                   /protein_id="YP_003397833.1"
FT   misc_feature    complement(129326..129850)
FT                   /note="Rnf-Nqr subunit, membrane protein; Region: Rnf-Nqr;
FT                   cl00597"
FT                   /db_xref="CDD:174301"
FT                   /locus_tag="Acfer_0109"
FT   gene            complement(129849..130445)
FT                   /db_xref="GeneID:8736547"
FT                   /locus_tag="Acfer_0110"
FT   CDS_pept        complement(129849..130445)
FT                   /locus_tag="Acfer_0110"
FT                   /gene_family="HOG000279325" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /codon_start="1"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   cpf:CPF_1319 electron transport complex RsxE subunit"
FT                   /db_xref="GI:284047495"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="GeneID:8736547"
FT                   /translation="MLHELTKGIIKENPLFVQLLGVCPSLATSTSLTNAIGMGCAFTFV
FT                   LVFTNMIIAAIRKLIPDQIHIPCYIVVIASVVTVLEMLMNAFVPALYAALGVFVPLIVV
FT                   NCIVLGRAEAFACDHGVIDSAMDAIGMGIGFTFALSCIAFFRELVGAGKLFDHAVLPAA
FT                   YQPVLIFILPAGAFLTMGFVFAAVNYFKERGAHNA"
FT                   /protein_id="YP_003397834.1"
FT   misc_feature    complement(129861..130436)
FT                   /note="Rnf-Nqr subunit, membrane protein; Region: Rnf-Nqr;
FT                   cl00597"
FT                   /db_xref="CDD:174301"
FT                   /locus_tag="Acfer_0110"
FT   gene            complement(130451..131020)
FT                   /db_xref="GeneID:8736548"
FT                   /locus_tag="Acfer_0111"
FT   CDS_pept        complement(130451..131020)
FT                   /locus_tag="Acfer_0111"
FT                   /gene_family="HOG000279313" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /codon_start="1"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   cbl:CLK_3558 electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /db_xref="GI:284047496"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="GeneID:8736548"
FT                   /translation="MSNLFVKYTGILAIICGVSVGLVAAANEGTKDTIAKKHEADTRAA
FT                   YKVVLPELGDLKKLPAPGGLITDVQQSSKDGKPNGYIYTVTPSGYGGKVTLMVGISKNG
FT                   DKITGIKVMNHSETPGLGAKSTEPEWQAQFKGKALKDALAVTKQEPAKPNEIKAITAAT
FT                   ITSRAVVTGVNAAREDYMKNHANGKD"
FT                   /protein_id="YP_003397835.1"
FT   misc_feature    complement(130472..130990)
FT                   /note="FMN-binding domain; Region: FMN_bind; cl01081"
FT                   /db_xref="CDD:174518"
FT                   /locus_tag="Acfer_0111"
FT   gene            complement(131017..132051)
FT                   /db_xref="GeneID:8736549"
FT                   /locus_tag="Acfer_0112"
FT   CDS_pept        complement(131017..132051)
FT                   /locus_tag="Acfer_0112"
FT                   /gene_family="HOG000273667" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /codon_start="1"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   ckr:CKR_1161 hypothetical protein"
FT                   /db_xref="GI:284047497"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="GeneID:8736549"
FT                   /translation="MEPIKEPKPLVLVSSSPHMHCGLTISKSMREVILALVPAVLASVY
FT                   YFRVDAVRVIVCCVLSAIIFEKLANKVMGVKKDTVKDGSAALTGLLLALCLPASLPSYM
FT                   AVLGGMFAVVIGKAIFGGLGKNIFNPAHIGRAILLASFPQQMTTWVIPATKAAAVTAAT
FT                   AGADATTAATPLAVMRMTEKVWQAGGAAASQLPPLSDLFMGNVGGSLGETCVPALVLGG
FT                   LYLIWKKLIDWRIPVFYLATVAVLTGIYGAVMGYPSTFPLYHLFAGGLMIGAFFMATDW
FT                   VTSPITKKGKIIYAIGLGVLTSLIRLRGSYTEGVCYSILMMNMVTPMIDRFVRNVSFGG
FT                   GQKK"
FT                   /protein_id="YP_003397836.1"
FT   misc_feature    complement(131035..132015)
FT                   /note="RnfE family; Region: NQR2_RnfD_RnfE; cl00779"
FT                   /db_xref="CDD:174386"
FT                   /locus_tag="Acfer_0112"
FT   gene            complement(132078..133445)
FT                   /db_xref="GeneID:8736550"
FT                   /locus_tag="Acfer_0113"
FT   CDS_pept        complement(132078..133445)
FT                   /locus_tag="Acfer_0113"
FT                   /gene_family="HOG000279299" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /codon_start="1"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; Soluble ligand binding domain; KEGG:
FT                   tex:Teth514_0079 electron transport complex, RnfABCDGE
FT                   type, C subunit"
FT                   /db_xref="GI:284047498"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="GeneID:8736550"
FT                   /translation="MSAQEASFMGGVEVPPSKSLTDKVAIERCPAPDVVYIPLSQHIGA
FT                   PAKPVVKPGDKVTIGQVIGEAGGFVSTNIHASVSGMVMKLENRYMPHGMISQCVVIKND
FT                   GQDTLCEDIKPRSEEEITPDLIRQVLREKGIAGMGGATFPTAVKYAPPKEGHCPIDTIL
FT                   LNGIECEPFVTADHRTLLEYADEIIQGLKYFMLASGAAKGIIGIEDNKPDAIELMQKKV
FT                   AGEANIEVCVCKEKYPQGSEKHLIYAATGRTVPDRGLPADVGVIVDNVGTAVAACRAVK
FT                   NNIPLYERVVTISGDGVNKPGNYIVRLGTLFSDAVEKAAGGLKGDPGKIVAGGMMMGFA
FT                   VNSLDYPITKGSSGLLIFNSKSPFAQYVEPDPCVHCARCVDACPMKLEPTEIVQAVKKQ
FT                   NWDDAERFFCHACIECGSCAFVCPAHIPLVQYIRMGKQFIRGKGDGGHNPFYKFDK"
FT                   /protein_id="YP_003397837.1"
FT   misc_feature    complement(132120..133427)
FT                   /note="C subunit; Region: rnfC; TIGR01945"
FT                   /db_xref="CDD:162617"
FT                   /locus_tag="Acfer_0113"
FT   misc_feature    complement(132621..133058)
FT                   /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
FT                   Region: Complex1_51K; pfam01512"
FT                   /db_xref="CDD:144926"
FT                   /locus_tag="Acfer_0113"
FT   misc_feature    complement(132426..132578)
FT                   /note="endonuclease III; includes endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
FT                   glycosidases (Alka-family) and other DNA glycosidases;
FT                   Region: ENDO3c; cl11430"
FT                   /db_xref="CDD:175252"
FT                   /locus_tag="Acfer_0113"
FT   misc_feature    complement(<132150..>132329)
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl00255"
FT                   /db_xref="CDD:174071"
FT                   /locus_tag="Acfer_0113"
FT   gene            133745..134653
FT                   /db_xref="GeneID:8736551"
FT                   /locus_tag="Acfer_0114"
FT   CDS_pept        133745..134653
FT                   /locus_tag="Acfer_0114"
FT                   /gene_family="HOG000008888" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dae:Dtox_3790 radical SAM domain
FT                   protein"
FT                   /db_xref="GI:284047499"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736551"
FT                   /translation="MFGLYFDDYDTPVFRPPSEANSFILRVTRGCAHNTCTFCAMYKDV
FT                   RFSVCPDEEISRQIALAARYARNQVKRIFLADGDALVLPTEKLLKILAVLYRTFPNLQR
FT                   VTSYAGPRDILRKSDEDMVRLREAGLKMLYFGLETGDDSLLARIKKGVTAEEAVAAGQK
FT                   VVRCGMKLSMMVIAGLGGKADSERHAVNTGKAVTAIQPNMLSVLTLRLYKGTEMLRQFE
FT                   AGEFELLSPAGLAREVHTMLENVEIRPENHTLFRSNHISNYVPLAGTLPQDRDRLLREL
FT                   DVSMEKLSKLTDWEVYTNMEY"
FT                   /protein_id="YP_003397838.1"
FT   misc_feature    133805..134395
FT                   /note="Radical SAM; Region: Elp3; smart00729"
FT                   /db_xref="CDD:128968"
FT                   /locus_tag="Acfer_0114"
FT   misc_feature    133817..134431
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0114"
FT   misc_feature    order(133835..133837,133841..133843,133850..133852,
FT                   133856..133864,133970..133972,133976..133981,
FT                   134066..134074,134150..134152,134270..134272,
FT                   134366..134371)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0114"
FT   gene            134873..135571
FT                   /db_xref="GeneID:8736552"
FT                   /locus_tag="Acfer_0115"
FT   CDS_pept        134873..135571
FT                   /locus_tag="Acfer_0115"
FT                   /gene_family="HOG000229978" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /codon_start="1"
FT                   /product="NLP/P60 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLP/P60 protein; Peptidoglycan-binding domain
FT                   1 protein; KEGG: cce:Ccel_2940 NLP/P60 protein"
FT                   /db_xref="GI:284047500"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:8736552"
FT                   /translation="MKLHKLVTALILAVLALPLSAGAAAHRTAPLKVGDKGWKVKTVQI
FT                   KLNAIGMKTPQTGKYTRELEGQVRNFQKEHRLPATGKVDDTTYFRIQEAAFEKEGIHGI
FT                   RGEDVVRTASRYKGVPYSFGGTTPRAFDCSGYVQYVFRQHRAQLPRTADLQYEKGLFVT
FT                   QRQLKPGDLVFFSTYEPGASHVGIYAGNGLFWNATSSRGVRLCSLSDDYWKSRYYGAKR
FT                   VLVPVHKSYR"
FT                   /protein_id="YP_003397839.1"
FT   misc_feature    134990..135136
FT                   /note="Putative peptidoglycan binding domain; Region:
FT                   PG_binding_1; pfam01471"
FT                   /db_xref="CDD:144895"
FT                   /locus_tag="Acfer_0115"
FT   misc_feature    135224..135538
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="Acfer_0115"
FT   gene            135593..137512
FT                   /db_xref="GeneID:8736553"
FT                   /locus_tag="Acfer_0116"
FT   CDS_pept        135593..137512
FT                   /locus_tag="Acfer_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /codon_start="1"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /transl_table="11"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; helix-turn-helix Fis-type; SMART: AAA ATPase; KEGG:
FT                   cba:CLB_1645 aco operon transcriptional regulator"
FT                   /db_xref="GI:284047501"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:8736553"
FT                   /translation="MIRERRNKEKLTSYYNKFVDEGIIDPNVHPWVAESWRRCEARKLE
FT                   HETMPANGVRLSPQELAKALEVHEDVVKYVDGLFEQNKQYFNSHNLSMLLVNEEGYVLK
FT                   NYALPFFQRSIEDIQGMRVLEEDVGTSSICVARSHNVPFLMFGPEMWIRESHSGDACSA
FT                   PIEVGGQCRYILSLFSLDQNDLPYDILLSLLMTMKYSVENFLNMLAYWKVCGLISEEIP
FT                   ASVYWVNQDGSLRYSNTNGKKRLDGKERLDEVFLNYEHIPIQKGLSGKSTIRKEITWIT
FT                   QERTYEDVTSVLPVKAGGKVDSVVIITMAIEDLKTTIAHATGYSSRYSLYSMVGNSSEF
FT                   LALQHKAARVARGDNNLLLQGEPGTGKQRLAHGIHQASPRAAAPLITVRGHDGSEAELE
FT                   AEFFGSDDGAGHVTAGALELANGGTLFLDEIEKFPTKLEDALADALRNGVRNWETGTRR
FT                   KYNVRVIAACDSNLKRLTDKGLFSRNLYEQVIGTVIRVPPLRERVEDVEVIANHILTEM
FT                   AARHNMPSKTLSREALQLLNSCQWPGNIKQLQGVIEQAFFHTSGSVIEASHIKLPGEHR
FT                   IEKSWKHDKDAFVAAWKAAGGNISKLALMLDVSRVTLYRYLKKFNLGPEEKKNRGKKAK
FT                   TEEK"
FT                   /protein_id="YP_003397840.1"
FT   misc_feature    135644..>136087
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    <136241..137458
FT                   /note="Transcriptional regulator containing PAS, AAA-type
FT                   ATPase, and DNA-binding domains [Transcription / Signal
FT                   transduction mechanisms]; Region: RocR; COG3829"
FT                   /db_xref="CDD:33622"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    136592..137086
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    136673..136696
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    order(136676..136699,136874..136876,136997..136999)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    136862..136879
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    137039..137041
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acfer_0116"
FT   misc_feature    137342..137452
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:174521"
FT                   /locus_tag="Acfer_0116"
FT   gene            137603..138244
FT                   /db_xref="GeneID:8736554"
FT                   /locus_tag="Acfer_0117"
FT   CDS_pept        137603..138244
FT                   /locus_tag="Acfer_0117"
FT                   /gene_family="HOG000251689" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /codon_start="1"
FT                   /EC_number="2.1.1.33"
FT                   /transl_table="11"
FT                   /note="KEGG: bpu:BPUM_2637 tRNA (guanine-N(7)-)-
FT                   methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="GI:284047502"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="GeneID:8736554"
FT                   /translation="MRLRKKPWIPQALEEYRGKELLEDGLEQYRGQWSQQVLGGRPVQL
FT                   EIGCGKGQFLAAMSQLHPEIGYLGIETQRDVCYYGVKKIREGEIPNARILHADAAHLLD
FT                   WFAPGEVDQIYLNFSDPWPKARHAKRRLTYRTFLAQYKEILKPGGHLRFKTDNDDLFAF
FT                   SVEEFKEFGLEIVALSTDLHHTDILNEAQTEYEQKFSARGKNINFCEVAF"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /protein_id="YP_003397841.1"
FT   misc_feature    137735..138055
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Acfer_0117"
FT   misc_feature    order(137741..137761,137813..137818,137891..137899,
FT                   137951..137953)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Acfer_0117"
FT   gene            138263..139468
FT                   /db_xref="GeneID:8736555"
FT                   /locus_tag="Acfer_0118"
FT   CDS_pept        138263..139468
FT                   /locus_tag="Acfer_0118"
FT                   /gene_family="HOG000282686" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /codon_start="1"
FT                   /product="cell cycle protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cell cycle protein; KEGG: mta:Moth_0842 cell
FT                   cycle protein"
FT                   /db_xref="GI:284047503"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="GeneID:8736555"
FT                   /translation="MGKRFLIWDNPRDALVNLVYFLMILGGVNIFSASFVAAADMFGNG
FT                   YHYLIRYAIYGAIGLGLMHWVGRKWDYHQFFRVDQLLCVGCTVLLIAVDIFGKATKGAQ
FT                   RWLILGPFSFQPSEFVKLAVILLGAHFLGRVMEQGKTPHLHRKDTCQAFLEAAFMSFLV
FT                   LIQPDMGTASIILTLMIVLYLLAGLPWKEFGILVGVLLGGAVAAVIQAPYRLNRMRIWL
FT                   TPELDPQGNGYQAVQAKMAIGSGGIFGEPFGMGTSKFFYLPEAHTDFAFAIFCQEWGFL
FT                   GALFLMLVFLLMGLALYRIGQNTQDRKGFLLVSGVNFLVVGQAIANMAMVCGILPVIGV
FT                   PLSFISYGGTSLIITLVGIGLVLSVYRMEMERGKQPAGSRVPPSGNRPFQPGRKETGRW
FT                   TR"
FT                   /protein_id="YP_003397842.1"
FT   misc_feature    138305..139303
FT                   /note="Cell cycle protein; Region: FTSW_RODA_SPOVE;
FT                   cl00511"
FT                   /db_xref="CDD:174253"
FT                   /locus_tag="Acfer_0118"
FT   gene            139465..141558
FT                   /db_xref="GeneID:8736556"
FT                   /locus_tag="Acfer_0119"
FT   CDS_pept        139465..141558
FT                   /locus_tag="Acfer_0119"
FT                   /gene_family="HOG000049553" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.129"
FT                   /transl_table="11"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; PASTA
FT                   domain containing protein; KEGG: chy:CHY_2075
FT                   penicillin-binding protein 2B"
FT                   /db_xref="GI:284047504"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="GeneID:8736556"
FT                   /translation="MKIPQFLQRKKKKTGPAPEKPVLKLDPNHQEILHEGKLRAVGLGK
FT                   FLGLAVLVIVVRLFWLQIVQGSTLAQEANDQITGEHTEIAPRGSIVDRNGEELAVSVIS
FT                   KSLYVDPQELVDNPDRWPAGKMPSRDPKKVAADALAPVLGLNANKLYEEFCEPDRRFIW
FT                   VKRTLDPHVADQVEAILKEQKLSGFHFKEESKRFYTKNDLAAQVLGFVGTDDKGLEGVE
FT                   ASMDDQLKGRNQKKRSFFDAKGNQVGQSAMNQVQVRRMNTVQLTIDARMQFILEKSLDE
FT                   AIKKTHAASAAAILMDPNTGEILGMASRPTFDPNHFAQAPKGAYMNRGVGIVYEPGSVF
FT                   KPIMGSAGLMEGVITPNTPFNDQGSIDVGGRRIRNWDGKGMGHVTFTDVIKFSLNTGMA
FT                   DLGLKLGGERETQYAKAFGFGSATGSDVPGEEAGILYNPKDMVPSDVATMAIGQGIAVT
FT                   PLQMLRAICAIANGGSLVKPYIVKKVTSPDGKVLQEGKTEVVRTVITPEVAEEMRTMME
FT                   KVVSEGGGKTAQIKGYKIAGKTGTAEKLSPKGGYIPGVYIASFVGFVPSDAPRYAMIIM
FT                   LDSPKGAFYGSQVSAPIFRDTLQQILVAEGVQPSNWDGLPTVESLLAKTAKEAAPLATL
FT                   EADGNGAVKLPNLAGHAIREVAAALSGANLALIPVGSGTSWKQNPAPGTILHKGDTVTV
FT                   YFR"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /protein_id="YP_003397843.1"
FT   misc_feature    139609..141552
FT                   /note="stage V sporulation protein D; Region: spoVD_pbp;
FT                   TIGR02214"
FT                   /db_xref="CDD:131269"
FT                   /locus_tag="Acfer_0119"
FT   misc_feature    139717..140211
FT                   /note="Penicillin-binding Protein dimerization domain;
FT                   Region: PBP_dimer; pfam03717"
FT                   /db_xref="CDD:146381"
FT                   /locus_tag="Acfer_0119"
FT   misc_feature    140344..141261
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="Acfer_0119"
FT   misc_feature    141394..141552
FT                   /note="PASTA domain of PBP2x-like proteins, second repeat.
FT                   Penicillin-binding proteins (PBPs) are the major targets
FT                   for beta-lactam antibiotics, like penicillins and
FT                   cephalosporins. Beta-lactam antibiotics specifically
FT                   inhibit transpeptidase activity by...; Region:
FT                   PASTA_Pbp2x-like_2; cd06575"
FT                   /db_xref="CDD:119326"
FT                   /locus_tag="Acfer_0119"
FT   gene            141574..142392
FT                   /db_xref="GeneID:8736557"
FT                   /locus_tag="Acfer_0120"
FT   CDS_pept        141574..142392
FT                   /locus_tag="Acfer_0120"
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /codon_start="1"
FT                   /EC_number="1.5.1.5"
FT                   /transl_table="11"
FT                   /note="PFAM: Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain; Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain; KEGG:
FT                   lsl:LSL_0533 methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="GI:284047505"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="GeneID:8736557"
FT                   /translation="MEPIIMAGKPVAEEIRRNLREKFAGKELTLATFLVGDNPAAHVYK
FT                   RSLLKTAASLGIHTRDVELPEGASQEEAERALRALSEDPRVDGILPLVPFPWHISRMQL
FT                   IRQLDPEKDMDCIHPINGGKLYLGITPWGPCTPRSCMALLDYYKIPLEGQHVVMVGYGE
FT                   VVGRPLTLMLMGRYATVTVCRSRTKNLPAITRQADIIISAVGKPDLITEDMIREGAVVV
FT                   DVGINSVDGKLVGDVSEAAKKVKASAYTPVPGGVGVVSNLMVMETLTRRL"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /protein_id="YP_003397844.1"
FT   misc_feature    141583..142383
FT                   /note="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase
FT                   [Coenzyme metabolism]; Region: FolD; COG0190"
FT                   /db_xref="CDD:30539"
FT                   /locus_tag="Acfer_0120"
FT   misc_feature    141583..141918
FT                   /note="Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   catalytic domain; Region: THF_DHG_CYH; pfam00763"
FT                   /db_xref="CDD:144385"
FT                   /locus_tag="Acfer_0120"
FT   misc_feature    141901..142383
FT                   /note="NADP binding domain of methylene-tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase; Region:
FT                   NAD_bind_m-THF_DH_Cyclohyd; cd01080"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Acfer_0120"
FT   misc_feature    order(141928..141933,141940..141942,142030..142032,
FT                   142036..142038,142054..142056,142081..142086,
FT                   142093..142095,142102..142119,142123..142125,
FT                   142129..142134,142159..142161)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Acfer_0120"
FT   misc_feature    order(141979..141981,142054..142059,142123..142128,
FT                   142183..142185,142189..142191,142198..142200,
FT                   142243..142245,142249..142251,142342..142344,
FT                   142351..142353)
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Acfer_0120"
FT   misc_feature    order(142330..142335,142354..142356)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Acfer_0120"
FT   gene            complement(142393..142788)
FT                   /db_xref="GeneID:8736558"
FT                   /locus_tag="Acfer_0121"
FT   CDS_pept        complement(142393..142788)
FT                   /locus_tag="Acfer_0121"
FT                   /gene_family="HOG000015131" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ccel_0086"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_0086 hypothetical protein"
FT                   /db_xref="GI:284047506"
FT                   /db_xref="GeneID:8736558"
FT                   /translation="MKEFRIGAVGEATDTVLHTNTAAAMGSGSLDVYATPAMLALMEKA
FT                   ACSIVNPCLDEETTSVGIGVNLSHDAATAVGKTVTAKAVLVGVDGRKLTFKITVSDNYG
FT                   TIGQGTHERFLVNKAKFLGKLAAKDQK"
FT                   /protein_id="YP_003397845.1"
FT   misc_feature    complement(142396..142722)
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:174252"
FT                   /locus_tag="Acfer_0121"
FT   gene            142927..143685
FT                   /db_xref="GeneID:8736559"
FT                   /locus_tag="Acfer_0122"
FT   CDS_pept        142927..143685
FT                   /locus_tag="Acfer_0122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gwc:GWCH70_1791 hypothetical protein"
FT                   /db_xref="GI:284047507"
FT                   /db_xref="GeneID:8736559"
FT                   /translation="MKKIILLGCLLLSLLLSGCAKGHITMEITRLGAADLTCRLVAAPV
FT                   LKPTVDAFQEDFRKDGYGVRPAKEGQYEGFVATKHYNQVKDIKDSKVLKTFDIGTWEKA
FT                   AQDAAGSQNGDKAKTASVTKEKKDPIVRLQGGLLFDTISVHTGINMAPKEELKNRDAQA
FT                   VLQNVLKQFDLRFTLVLPTGVDATNATQVSDDKRILTWKLPLGEETPMEATVTYLNPVK
FT                   AAGWLMVLLVVGGVGNAYYRKRKRMEKAGA"
FT                   /protein_id="YP_003397846.1"
FT   gene            143932..144327
FT                   /db_xref="GeneID:8736560"
FT                   /locus_tag="Acfer_0123"
FT   CDS_pept        143932..144327
FT                   /locus_tag="Acfer_0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02641"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF190"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   dsa:Desal_1826 protein of unknown function DUF190"
FT                   /db_xref="GI:284047508"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="GeneID:8736560"
FT                   /translation="MADFLHLTKLTIYVGEDFFYKDKPFYKAIFDIAGKYKIAGCTVLR
FT                   GTQGYGSRVRGKERRLFISVSEAINLPVIITMIDTKEQIELMYPFLEENLRHGVATVEE
FT                   IDMLATNYVKEEYRKKIENRDNPEMQK"
FT                   /protein_id="YP_003397847.1"
FT   misc_feature    143953..144255
FT                   /note="Uncharacterized ACR, COG1993; Region: DUF190;
FT                   cl00872"
FT                   /db_xref="CDD:120193"
FT                   /locus_tag="Acfer_0123"
FT   gene            144427..144903
FT                   /db_xref="GeneID:8736561"
FT                   /locus_tag="Acfer_0124"
FT   CDS_pept        144427..144903
FT                   /locus_tag="Acfer_0124"
FT                   /gene_family="HOG000040372" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.4.1.21"
FT                   /codon_start="1"
FT                   /EC_number="4.4.1.21"
FT                   /transl_table="11"
FT                   /note="PFAM: LuxS protein; KEGG: bln:Blon_2000
FT                   S-ribosylhomocysteinase"
FT                   /db_xref="GI:284047509"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="GeneID:8736561"
FT                   /translation="MEKVIIESFTLDHTKVKAPYVRLIGQETGEHGDIVSNFDIRLCQP
FT                   NQQEIPTGGMHTLEHLLALYLRPRIKGYLDCSPFGCRTGFHLLCWGVHDPKDVAKALKE
FT                   ALELVVETTWDQVPGTKEKECGNYKDHSLFCAQEWAKEILAKGISSDPYERKIV"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /protein_id="YP_003397848.1"
FT   misc_feature    144427..144891
FT                   /note="S-Ribosylhomocysteinase (LuxS); Region: LuxS;
FT                   cl00802"
FT                   /db_xref="CDD:174395"
FT                   /locus_tag="Acfer_0124"
FT   gene            complement(144957..146687)
FT                   /db_xref="GeneID:8736562"
FT                   /locus_tag="Acfer_0125"
FT   CDS_pept        complement(144957..146687)
FT                   /locus_tag="Acfer_0125"
FT                   /gene_family="HOG000245545" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: lbu:LBUL_0873 signal transduction histidine
FT                   kinase"
FT                   /db_xref="GI:284047510"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:8736562"
FT                   /translation="MKKQIYLHLFLVGLACILVTALVCAFASWQTAKQQTLADLQQVAQ
FT                   VLGTDLEHHSDPYVFLKRSGQASPDLRLTWVDTHGTVLYDSFEDATAMPNHRERPEIAQ
FT                   ALGEGQGSNARHSATLQEVTLYAAQRLSDGSVLRLARTQTDLLRPLEALLPWWLFSLLL
FT                   LILICQFTVRRLTQGLLDPLEQATRYLSQIGQGDTSEEEKQLFHTSYPELLPFLATIDR
FT                   QGKQLDQSLRNLEQERNTMKRITDSLKEGVILLDDQMRIQWINAWGFQLLQQEERPTAG
FT                   RPRILGKFLMPFLPPEARTSLDQLRNSRAWNRTVKYRSRQYQLDLQPLEPPQGRASRML
FT                   IIQDITEAREREQLRRDFTANVTHELKTPLTSISGFAELMAAGMYQKKEDITHFGQLIR
FT                   KEAARLLEMINSIIFLSRIEEVPAEALQEEVPLGGLIQSVVEFMDPFCKDRQVTIHCHL
FT                   TEDKVRGSSSMLREMAMNLIDNGVKYNRPGGHVYVTMGRDGDQVVLTVKDTGIGIPEDV
FT                   QERVFERFYRVEGSRSKQSGGSGLGLSIVKHIVEQHRGKIRLTSRVNEGTSIEVQLPRA
FT                   "
FT                   /protein_id="YP_003397849.1"
FT   misc_feature    complement(144987..145988)
FT                   /note="phosphate regulon sensor kinase PhoR; Region:
FT                   phoR_proteo; TIGR02966"
FT                   /db_xref="CDD:163090"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(145437..145634)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(order(145452..145454,145464..145466,
FT                   145473..145475,145485..145487,145494..145496,
FT                   145506..145508,145560..145562,145569..145571,
FT                   145581..145583,145590..145592,145602..145604,
FT                   145614..145616))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(145596..145598)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(144969..145280)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(order(144981..144983,144987..144992,
FT                   145005..145007,145011..145013,145059..145070,
FT                   145149..145154,145158..145160,145164..145166,
FT                   145170..145172,145239..145241,145248..145250,
FT                   145260..145262))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(145248..145250)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0125"
FT   misc_feature    complement(order(145062..145064,145068..145070,
FT                   145152..145154,145158..145160))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0125"
FT   gene            complement(146703..147380)
FT                   /db_xref="GeneID:8736563"
FT                   /locus_tag="Acfer_0126"
FT   CDS_pept        complement(146703..147380)
FT                   /locus_tag="Acfer_0126"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: cth:Cthe_1600 two component transcriptional
FT                   regulator"
FT                   /db_xref="GI:284047511"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736563"
FT                   /translation="MALIYCVEDDENIRELVRYALCSQKFQAEAFPDGPSFWKALEAKQ
FT                   PDLVLLDIMLPGESGLDILKKLRDSQATSGLPVIMLTARTSEYDVVTGLDAGADDYISK
FT                   PFGIMELLSRVKAVLRRGGRQKPQDRNLLVCGDITLDLKKHRVTTQGQPCELTVKEFDL
FT                   LHYLMANAGIVLSRDQIMEAVWSFSYAGESRTIDMHIRSLRQKLGEAGRIIQTVRGVGY
FT                   RIQ"
FT                   /protein_id="YP_003397850.1"
FT   misc_feature    complement(146706..147371)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(147024..147365)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(order(147066..147071,147078..147080,
FT                   147135..147137,147201..147203,147225..147227,
FT                   147354..147359))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(147225..147227)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(order(147201..147209,147213..147218))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(147063..147071)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(146709..146984)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0126"
FT   misc_feature    complement(order(146718..146720,146733..146735,
FT                   146760..146765,146787..146789,146796..146798,
FT                   146850..146855,146910..146912))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0126"
FT   gene            147575..147883
FT                   /db_xref="GeneID:8736564"
FT                   /locus_tag="Acfer_0127"
FT   CDS_pept        147575..147883
FT                   /locus_tag="Acfer_0127"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /codon_start="1"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: bcv:Bcav_2432
FT                   peptidoglycan-binding LysM"
FT                   /db_xref="GI:284047512"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="GeneID:8736564"
FT                   /translation="MKKLLLGLVLVLLGVSSYGVLQMEAAPTRYRNQQVVVFRGDSLWG
FT                   IARRYTRPEEDVREVIDRIAKANHLDLRQAIQPGQKLTVPVKQGKPEKTEKMMASRS"
FT                   /protein_id="YP_003397851.1"
FT   misc_feature    147677..147829
FT                   /note="Lysin domain, found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function; Region: LysM;
FT                   cl00107"
FT                   /db_xref="CDD:153515"
FT                   /locus_tag="Acfer_0127"
FT   gene            148282..149245
FT                   /db_xref="GeneID:8736565"
FT                   /locus_tag="Acfer_0128"
FT                   /pseudo
FT   gene            149365..150612
FT                   /db_xref="GeneID:8736566"
FT                   /locus_tag="Acfer_0129"
FT   CDS_pept        149365..150612
FT                   /locus_tag="Acfer_0129"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dma:DMR_40670 hypothetical protein"
FT                   /db_xref="GI:284047513"
FT                   /db_xref="GeneID:8736566"
FT                   /translation="MTEEMDKRDAMDQEEDAVEAETRPMDEEVEEEDTLGPEDIARESE
FT                   RIIRWGAARASVIVMTPFLGSLALMANEVYMITRLCDLRGVELETGAIAGLVGSLGASF
FT                   VGQTVFTVIPFPPLQVPMAVGITYAVGKAANAWLDAGRPDDLSQFKGLYEQARKEGMEK
FT                   FREFTRDKNRNIPLGDERRKVAEKAKPIFDKLKTRADEAADRLGEVAENMGTYVEDFNM
FT                   LVAPFKDAVSRWVNAQTWEQLRRGELAVPYTDLAKGLGEAMKDSEFQFRECRYKGDHQL
FT                   EITVEHEKYGTLTADVEIEALALNNTASYARFRIHDFAIADNKLGELLVRLLGTRIIMS
FT                   LVNAIFNMTVVNRDDLICTFSDKSLTVDFTDVIKKSKLAQMTIKGFNLFDLVRLTGLVP
FT                   EADGLHIYSQWGLKKK"
FT                   /protein_id="YP_003397852.1"
FT   misc_feature    149491..>149775
FT                   /note="Domain of unknown function (DUF697); Region: DUF697;
FT                   cl12064"
FT                   /db_xref="CDD:159724"
FT                   /locus_tag="Acfer_0129"
FT   gene            150817..152256
FT                   /db_xref="GeneID:8736567"
FT                   /locus_tag="Acfer_0130"
FT   CDS_pept        150817..152256
FT                   /locus_tag="Acfer_0130"
FT                   /gene_family="HOG000279222" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /codon_start="1"
FT                   /product="carbon starvation protein CstA"
FT                   /transl_table="11"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   tde:TDE0012 carbon starvation protein CstA, putative"
FT                   /db_xref="GI:284047514"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="GeneID:8736567"
FT                   /translation="MISFFVCLAILIGGYFIYGGYVESCFRPPIDDRKTPAYRLEDGVD
FT                   YVPMENWRVFLIQLLNIAGLGPIFGALAGAMWGPAVFLWITFGTVFAGGVHDFISGVLS
FT                   ERNDGASISELCGKYLGPTMRHIMRGFSVVLLILVGVAFTTGPAGLLTKITPMSYNFWL
FT                   VVLLIYYFCATFLPVDKLIGKLYPFFGFCLIFMAVGVGTMLFAEGYHVPEIALTNMHPK
FT                   GTPIWPIMFITVACGAISGFHSTQSPIMARCIKSERDCHKIFYGAMVCEGIIALIWAAA
FT                   GVSFYGNTAGLGEAFVKYHGAGGVVYDICSGLMGYLGTVIAMIGVIACPVSSADTAFRS
FT                   ARYTLVDWFKIDQHTLSSRLRLAVPIIAVGGILTQVDVTILWRYFSWTNQTLAMLVLWS
FT                   GAMYLYANKGNAWIAIIPATFMSAVSCTYILVAKEGLQLSTSVAYPVGVAFAIVAFCLF
FT                   WKRAKKVDRGELDIADKPVQG"
FT                   /protein_id="YP_003397853.1"
FT   misc_feature    150907..151671
FT                   /note="Carbon starvation protein CstA; Region: CstA;
FT                   cl00856"
FT                   /db_xref="CDD:154042"
FT                   /locus_tag="Acfer_0130"
FT   gene            152621..154048
FT                   /db_xref="GeneID:8736568"
FT                   /locus_tag="Acfer_0131"
FT   CDS_pept        152621..154048
FT                   /locus_tag="Acfer_0131"
FT                   /gene_family="HOG000230998" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="FAD linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   amt:Amet_3747 FAD linked oxidase domain- containing
FT                   protein"
FT                   /db_xref="GI:284047515"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="GeneID:8736568"
FT                   /translation="MEHKYNPVTPELVEELKKVVGDRYVKTDEEYLEQYQTDEEGNPHF
FT                   FKKPEVVVFPGTTEEVAEVVKLANKFLVPITPRSAGTGVACGAIPIYHGMVVELQRMNK
FT                   ILKLDADNFYAVCQTGVFTGQLQAEARKAGVMYAGDPSSAESCQIGGNVANNAGGNRAV
FT                   RYGTTRDQIYALKVVTPTGDIVDVGARLKKCSTGLCLEQLFAGSEGTLGIITEVTVKLR
FT                   PLPPYSFNMVCVFNTDKEAFALPNKILKAGIDPTSIEYMGNSAIDMTCKYLDNMDMPHV
FT                   KEGCCYVIVTVESFDQDESDRKMEKLCDLAEANGSIDEFEADQRIWTLRKQFAEAARDI
FT                   DRMFQTEDFVVPLDKIAEMTAQIPELEKKYNLYTVTVAHIGDGNIHVLPLNKYGLSPEE
FT                   WFKTIKAFHADLFPRVYALGGKMSGEHGIGYKKLEEFARCTPEGEVKLIKAIKQALDPN
FT                   NIMNPGKLVDVNGDFVA"
FT                   /protein_id="YP_003397854.1"
FT   misc_feature    152663..154021
FT                   /note="FAD/FMN-containing dehydrogenases [Energy production
FT                   and conversion]; Region: GlcD; COG0277"
FT                   /db_xref="CDD:30625"
FT                   /locus_tag="Acfer_0131"
FT   misc_feature    152765..153184
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Acfer_0131"
FT   gene            154166..155446
FT                   /db_xref="GeneID:8736569"
FT                   /locus_tag="Acfer_0132"
FT   CDS_pept        154166..155446
FT                   /locus_tag="Acfer_0132"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047516"
FT                   /db_xref="GeneID:8736569"
FT                   /translation="MKPSKGKRLLLALVLWGSLLPAAWAAGTGTTEYGMGAESLAAAGP
FT                   APSGKLAVSQPLGETGALRQKDLKAELLARYGERKKRQPVVFRDPKNDVHFALPDGFSL
FT                   QGVYGRGKNQEDILMRASRGDTLLVYMANGAMMKTEGQKEAKPFQSEKVMLELTARTYE
FT                   EEARTRGIPVQVSEMGTFAGRDGLHIRQLEEGKVSDRYFFGDRKKLYSLSFLSPEKEAG
FT                   TLDPAVRQVLDSLEIGTAYERVRLPHSGVSYEIPFGSVDIQKAADPDDPHRLTRLHLDS
FT                   QLITGVIFQPLQESQDYAFLPDSLEGLCPQDRENLCRLMTENRRTRWERSHPGQILKEN
FT                   RTYFSQAAGRPCIVEDMVLPGGKSLGYVFLRKGTLLSLDYFQLGARDQQKIIDYSINSL
FT                   QWKDTDTVVRAGKKGPEKPLKPKYGGE"
FT                   /protein_id="YP_003397855.1"
FT   gene            155474..156247
FT                   /db_xref="GeneID:8736570"
FT                   /locus_tag="Acfer_0133"
FT   CDS_pept        155474..156247
FT                   /locus_tag="Acfer_0133"
FT                   /gene_family="HOG000085951" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /codon_start="1"
FT                   /product="Silent information regulator protein Sir2"
FT                   /transl_table="11"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: lsl:LSL_0203 NAD-dependent deacetylase"
FT                   /db_xref="GI:284047517"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="GeneID:8736570"
FT                   /translation="MEQKEFAQDVDTLDAWIREADHIVFFGGAGVSTASGIPDFRSKDG
FT                   LYNQHDVRFDQYRPEYLLSHSCLVNEPKVYFEFHRQKMDTRKIQPNNAHKYLAALEKTG
FT                   KLDGIVTQNIDGLHQKAGSRKVYEIHGSALRNYCMSCGKRYPSDYIFESKEPIPHCTCG
FT                   GVIRPDITLYEEMLPDEAVENAVRAISRADLMIIAGTSLTVYPAASFINYFHGKRLVIL
FT                   NRDPLSVHMKAETLVITENMDKVFKALAEKEGIAL"
FT                   /protein_id="YP_003397856.1"
FT   misc_feature    155510..156211
FT                   /note="SIR2 superfamily of proteins includes silent
FT                   information regulator 2 (Sir2) enzymes which catalyze
FT                   NAD+-dependent protein/histone deacetylation, where the
FT                   acetyl group from the lysine epsilon-amino group is
FT                   transferred to the ADP-ribose moiety of NAD+...; Region:
FT                   SIR2; cl00195"
FT                   /db_xref="CDD:174025"
FT                   /locus_tag="Acfer_0133"
FT   gene            156327..157607
FT                   /db_xref="GeneID:8736571"
FT                   /locus_tag="Acfer_0134"
FT   CDS_pept        156327..157607
FT                   /locus_tag="Acfer_0134"
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.11"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_2697 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="GI:284047518"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR018156"
FT                   /db_xref="GeneID:8736571"
FT                   /translation="MLDLKFVRDNTEKVAQALKNRHAKVDLEEFKKLDQERRSLLQEVE
FT                   ADKSQRNTVSAEISQMKRNGEDATEKITAMRALGDKIAEADKKVKDVEARLQAVMLTIP
FT                   NMPAADVPVGKDDTENPEVRKWGEPTHFDFEPKAHWEIGEKLGILDAERAAKVSGARFY
FT                   YYKGAGARLERAVYNFMLDQHTRKDGYMEVIPPYIVNTASMTGTGQLPKFHEDMYKVEG
FT                   QDMYLIPTAEVPLTNYYRGEILNGDDLPIYLTAMTPCFRAEAGSAGRDTRGLIRQHQFH
FT                   KVEMVKFCKPETSYDELEKLVGNAEDILKALKLPYHVVCLCTGDLGFSAAKCYDVEVWF
FT                   PEQNKYREISSCSNTEDFQARRANIRFRRDAKSKPEYVHTLNGSGLAVGRTVAAILENY
FT                   QQADGSVVVPEVLRPYMGCDVITGANS"
FT                   /product="seryl-tRNA synthetase"
FT                   /protein_id="YP_003397857.1"
FT   misc_feature    156327..157598
FT                   /note="seryl-tRNA synthetase; Provisional; Region:
FT                   PRK05431"
FT                   /db_xref="CDD:168043"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    156327..156647
FT                   /note="Seryl-tRNA synthetase N-terminal domain; Region:
FT                   Seryl_tRNA_N; pfam02403"
FT                   /db_xref="CDD:145510"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    156681..157574
FT                   /note="Seryl-tRNA synthetase (SerRS) class II core
FT                   catalytic domain. SerRS is responsible for the attachment
FT                   of serine to the 3' OH group of ribose of the appropriate
FT                   tRNA. This domain It is primarily responsible for
FT                   ATP-dependent formation of the enzyme...; Region:
FT                   SerRS_core; cd00770"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    order(156783..156800,156807..156827,156837..156839,
FT                   156843..156845,156849..156851,156858..156860,
FT                   156897..156908,156912..156920,156924..156926,
FT                   156978..156983,156987..156989,156999..157001,
FT                   157026..157028,157038..157040,157050..157052,
FT                   157098..157100,157161..157163,157569..157574)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    order(156804..156806,157014..157016,157020..157022,
FT                   157107..157109,157113..157115,157131..157133,
FT                   157140..157142,157149..157151,157155..157157,
FT                   157164..157166,157170..157172,157176..157178,
FT                   157368..157379,157470..157472,157476..157478,
FT                   157494..157496)
FT                   /note="active site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    156897..156920
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    157104..157115
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   misc_feature    order(157479..157487,157494..157496)
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Acfer_0134"
FT   gene            157950..159119
FT                   /db_xref="GeneID:8736572"
FT                   /locus_tag="Acfer_0135"
FT   CDS_pept        157950..159119
FT                   /locus_tag="Acfer_0135"
FT                   /gene_family="HOG000274133" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.18"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.18"
FT                   /transl_table="11"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: rba:RB8469
FT                   lysine/ornithine decarboxylase"
FT                   /db_xref="GI:284047519"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="GeneID:8736572"
FT                   /translation="MNEQSFFQLTQDAVTSLAERYGTPLLVLSLEQVEKNYDILREHIP
FT                   QLKIHYAMKANPDLHILDLLINKGACFDVASDGEIRTLSQLGVSGDRMIYANPIKLDAG
FT                   FRACNDAGVYRMTYDSESEIRKIAEHCPGATVLLRLRIDNAKAHVDLNKKFGCPREKAL
FT                   DLMLKAKEAGLDVAGIAFHVGSQTVSADPYFHAMDITRELMAEARARGLSMRVLDIGGG
FT                   FPIPETGVHYNLTALLDQVAARLREDFSDLEIWAEPGRYMCGTAVNLITRVIGENERNG
FT                   QNWYFLDDGIYGTFSGVIFDQWDFKLISFKDGKKIPATFAGPSCDSLDIMFRGKMTEPL
FT                   EVGDLLLVPVCGAYTSASATTFNGFKKARTVIWEEVREELGLDAMSVAV"
FT                   /product="Lysine decarboxylase"
FT                   /protein_id="YP_003397858.1"
FT   misc_feature    157989..159068
FT                   /note="Diaminopimelate decarboxylase [Amino acid transport
FT                   and metabolism]; Region: LysA; COG0019"
FT                   /db_xref="CDD:30369"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    158013..159068
FT                   /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
FT                   Enzyme Ornithine Decarboxylase; Region: PLPDE_III_ODC;
FT                   cd00622"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    order(158016..158018,158109..158111,158172..158177,
FT                   158181..158186,158250..158252,158265..158267,
FT                   158304..158306,158313..158315,158325..158327,
FT                   158406..158414,158769..158771,158775..158780,
FT                   158799..158801,158805..158807,158811..158813,
FT                   158820..158825,158847..158849,158853..158855,
FT                   158913..158915,158919..158921,158925..158927,
FT                   158934..158936,159021..159023,159027..159029,
FT                   159033..159041,159045..159047)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    order(158103..158105,158109..158111,158166..158168,
FT                   158364..158366,158493..158495,158502..158504,
FT                   158610..158615,158718..158729,158850..158852,
FT                   158922..158924,159009..159011)
FT                   /note="active site"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    order(158103..158105,158109..158111,158166..158168,
FT                   158364..158366,158493..158495,158502..158504,
FT                   158610..158615,158718..158729,158922..158924,
FT                   159009..159011)
FT                   /note="pyridoxal 5'-phosphate (PLP) binding site; other
FT                   site"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    order(158109..158111,158922..158924)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   misc_feature    order(158847..158852,158922..158927,159009..159011,
FT                   159033..159035)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:143482"
FT                   /locus_tag="Acfer_0135"
FT   gene            complement(159167..160300)
FT                   /db_xref="GeneID:8736573"
FT                   /locus_tag="Acfer_0136"
FT   CDS_pept        complement(159167..160300)
FT                   /locus_tag="Acfer_0136"
FT                   /gene_family="HOG000275009" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.25"
FT                   /transl_table="11"
FT                   /note="KEGG: cbl:CLK_2222 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="GI:284047520"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="GeneID:8736573"
FT                   /translation="MKAICNGRFILPQEIREGQALVFDERIRGFCSPDRIPPEAERIDV
FT                   QGAYVSPGFLNLHIHGCGGRDAMDGSREALETMSRLLPATGVTGWLPTTMTSSETAISQ
FT                   ALSAIREARGRVPGAEILGANLEGPFISEKYKGAQKACHIRKACWELVEPFAGLIRLLT
FT                   LAPETLEDMDFISRCRRAGIIVSLGHSDATWEEAARAVTAGASHITHLYNAMSPLHHRK
FT                   PGLVGAALTLPVTCELIADGIHIHPAALALAIQAKGLDRVELITDSMRACLLGEGKSEL
FT                   GGQTVYVKDGRATLEDGTLAGSILTMDRAVRNIRSWAHLTLPQAVQLATVNPARELGLT
FT                   DRGTLEPGKRADITVFDEDFRILGTYVKGSAVYTTDQ"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /protein_id="YP_003397859.1"
FT   misc_feature    complement(159224..160300)
FT                   /note="Imidazolonepropionase and related amidohydrolases
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]; Region: HutI; COG1228"
FT                   /db_xref="CDD:31421"
FT                   /locus_tag="Acfer_0136"
FT   misc_feature    complement(159194..160297)
FT                   /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
FT                   catalyzes the hydrolysis of the N-acetyl group of
FT                   N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
FT                   glucosamine 6-phosphate and acetate. This is the first
FT                   committed step in the biosynthetic pathway to...; Region:
FT                   NagA; cd00854"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="Acfer_0136"
FT   misc_feature    complement(order(159401..159403,159500..159502,
FT                   159569..159571,159659..159664,159671..159673,
FT                   159734..159736,159887..159889,159920..159922,
FT                   160121..160123,160127..160129))
FT                   /note="active site"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="Acfer_0136"
FT   misc_feature    complement(order(159536..159538,159545..159550,
FT                   159554..159559,159563..159574,159608..159613,
FT                   159632..159634,159638..159643,159647..159649,
FT                   159665..159667))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="Acfer_0136"
FT   gene            160398..161234
FT                   /db_xref="GeneID:8736574"
FT                   /locus_tag="Acfer_0137"
FT   CDS_pept        160398..161234
FT                   /locus_tag="Acfer_0137"
FT                   /gene_family="HOG000084045" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /codon_start="1"
FT                   /product="glucokinase regulatory-like protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; PFAM:
FT                   sugar isomerase (SIS); KEGG: cbe:Cbei_1917 N-acetylmuramic
FT                   acid-6- phosphate etherase"
FT                   /db_xref="GI:284047521"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="GeneID:8736574"
FT                   /translation="MIDLDRLSTEQRNPASVAIDKVSTQEMMEIINREDHKVADAVEKI
FT                   LPAIALAVDLVADRLSRGGRLFYMGSGTSGRLGILDAVECPPTYSTDPEQIQGLIAGGY
FT                   EAIFRAKEGAEDSEEQGRDDIWNKELTPLDVVMGISASGRTPYVLGGMKEARERGCAVL
FT                   GLCCSRQSAMAKLADLCLTVLPGPEVITGSTRMKAGTATKMVLNMITTGAMVKLGKVRG
FT                   NLMIDVRATNEKLLERALHIVCTVTGCSREEARLSLARNRGSARKAVEEWEAAHGK"
FT                   /protein_id="YP_003397860.1"
FT   misc_feature    160413..161204
FT                   /note="N-acetylmuramic acid-6-phosphate etherase; Reviewed;
FT                   Region: murQ; PRK05441"
FT                   /db_xref="CDD:168049"
FT                   /locus_tag="Acfer_0137"
FT   misc_feature    160440..161204
FT                   /note="N-acetylmuramic acid 6-phosphate etherase. Members
FT                   of this family contain the SIS (Sugar ISomerase) domain.
FT                   The SIS domain is found in many phosphosugar isomerases and
FT                   phosphosugar binding proteins. The bacterial cell wall
FT                   sugar N-acetylmuramic acid...; Region: SIS_Etherase;
FT                   cd05007"
FT                   /db_xref="CDD:88404"
FT                   /locus_tag="Acfer_0137"
FT   misc_feature    order(160617..160619,160815..160817)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:88404"
FT                   /locus_tag="Acfer_0137"
FT   gene            161224..162627
FT                   /db_xref="GeneID:8736575"
FT                   /locus_tag="Acfer_0138"
FT   CDS_pept        161224..162627
FT                   /locus_tag="Acfer_0138"
FT                   /gene_family="HOG000102024" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02378"
FT                   /codon_start="1"
FT                   /product="phosphotransferase system EIIC"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphotransferase system EIIC;
FT                   Phosphotransferase system EIIB/cysteine, phosphorylation
FT                   site; KEGG: cbb:CLD_3191 PTS system, IIBC components"
FT                   /db_xref="GI:284047522"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="GeneID:8736575"
FT                   /translation="MENKELAREIFRIVGPGENVRQASHCMTRLRLQLDRQDVDRDALK
FT                   KLPGVMGVNQAGPELQIILGPGKAAQVTEAFQALLQEAPDGTEPGKPDAQEPDLRAFAG
FT                   KVGDGKELHEAIRARNATPGKLFLKRIAGIFVPLIPGFIGCGLLTGILNIVRRLDPQLA
FT                   GHGFFQILGLAGSTVFWGMNLFVGWNAAREFGGSPVLGGALGALISHPGLAGLTLYGQP
FT                   LTPGRGGVVAVLLAAALGALLEKKIRRMVPEALDLFLTPFLVLGIMAFATLCVFQPVGG
FT                   WAAEGIGYAATEAVSRGGAFTGFVLGGLFLPLVMLGVHQGLTPIHAQLIAQYGYTILLP
FT                   ILAMAGGGQVGAALAVYLKTKDPRIRKVVASALPVGLLGVGEPLIYGVTLPLGRPFIGA
FT                   CIGGAAGGAVQAAFQVGAGALGISGLPLAPSTTNVPMYLLGLLVSYGVGFLATWVLGFE
FT                   EKSAGGMQS"
FT                   /protein_id="YP_003397861.1"
FT   misc_feature    161233..161463
FT                   /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIB_glc;
FT                   cl00164"
FT                   /db_xref="CDD:163728"
FT                   /locus_tag="Acfer_0138"
FT   misc_feature    161296..161316
FT                   /note="active site turn"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="Acfer_0138"
FT   misc_feature    161299..161301
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="Acfer_0138"
FT   misc_feature    161578..>162408
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="Acfer_0138"
FT   gene            162624..163694
FT                   /db_xref="GeneID:8736576"
FT                   /locus_tag="Acfer_0139"
FT   CDS_pept        162624..163694
FT                   /locus_tag="Acfer_0139"
FT                   /gene_family="HOG000030880" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05913"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF871"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF871; KEGG:
FT                   cbe:Cbei_1919 hypothetical protein"
FT                   /db_xref="GI:284047523"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="GeneID:8736576"
FT                   /translation="MTKLTKGISLYPGLGRPLEENLRRLEKAAELGITRLFLSFHIPET
FT                   DPAAFDREVEPLLRRARSLGLETVGDLVPGRPVPEDLTFLRLDDGYTPEAMAALQKKYP
FT                   DRTLVLNASALTEDQLETLDRQGVDLGRVAALHNFYPHPHTGLSEEYLLRQNRLFHRYG
FT                   IPVGAFAASQSGKRGPLGEGLPTLEQARHRSVSLAARQLAALGIDGIYIGDDGPDRQEL
FT                   EALARVSGEVLELTLQVWEDRPLYGVLAGHVYETRPDEAEEVIRTVNSRALWKGVEIPE
FT                   YPFRRCHAGDVTLDNPLYGRYAGELEICKTELPADRRVDVLGRIPEEERFLLRYLKGGK
FT                   KFRFRVVEMNPRGSGI"
FT                   /protein_id="YP_003397862.1"
FT   misc_feature    162642..163661
FT                   /note="Bacterial protein of unknown function (DUF871);
FT                   Region: DUF871; pfam05913"
FT                   /db_xref="CDD:147844"
FT                   /locus_tag="Acfer_0139"
FT   misc_feature    162642..163655
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3589"
FT                   /db_xref="CDD:33389"
FT                   /locus_tag="Acfer_0139"
FT   gene            163733..164842
FT                   /db_xref="GeneID:8736577"
FT                   /locus_tag="Acfer_0140"
FT   CDS_pept        163733..164842
FT                   /locus_tag="Acfer_0140"
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /codon_start="1"
FT                   /product="GTP-binding protein YchF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP- binding protein HSR1-related;
FT                   KEGG: dhd:Dhaf_4937 GTP-binding protein YchF"
FT                   /db_xref="GI:284047524"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="GeneID:8736577"
FT                   /translation="MSSTNLEMGIVGLPNVGKSTLFNAITKAGAEAANYPFCTIEPNVG
FT                   VVDVPDARLKVLADMFHSKKIVPAGMKFVDIAGLVKGASKGEGLGNKFLSHIRQTDAIA
FT                   EVVRCFEDGNITHVEGSIDPVRDVEIINTELCLADLESVEKQLVKAQKLIKAGDKKAAA
FT                   RAALLQRISDALGEGIPVRRVEMTDDEKAGLKELDLLTSKPILYVANVAEEEAADWSGN
FT                   AYVKTLEDYAAQENAQVIVISAKVEEEIAELPEDEAKEYLEMEGLTEAGLDRLIKAGFK
FT                   LLGLQTFLTAGEMESRAWTIVQGSTAPQAAGKIHTDFEKGFIRAEIVSYDDLVKCGSKQ
FT                   AAKEKGLVRLEGKDYIMQDGDVVEFRFNV"
FT                   /protein_id="YP_003397863.1"
FT   misc_feature    163748..164839
FT                   /note="GTP-dependent nucleic acid-binding protein EngD;
FT                   Reviewed; Region: PRK09601"
FT                   /db_xref="CDD:170000"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    163754..164581
FT                   /note="YchF subfamily.  YchF is a member of the Obg family,
FT                   which includes four other subfamilies of GTPases: Obg, DRG,
FT                   Ygr210, and NOG1.  Obg is an essential gene that is
FT                   involved in DNA replication in C. crescentus and
FT                   Streptomyces griseus and is associated...; Region: YchF;
FT                   cd01900"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    163766..163789
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    order(163775..163777,163781..163792,164360..164365,
FT                   164369..164371,164459..164467)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    163835..163858
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    163847..163849
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    order(163952..163981,164000..164029)
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    163955..163966
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    164360..164371
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    164459..164467
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133300"
FT                   /locus_tag="Acfer_0140"
FT   misc_feature    164585..164833
FT                   /note="TGS_YchF_C: This subfamily represents TGS
FT                   domain-containing YchF GTP-binding protein, a universally
FT                   conserved GTPase whose function is unknown. The N-terminal
FT                   domain of the YchF protein belongs to the Obg-like family
FT                   of GTPases, and some members of the...; Region: TGS_YchF_C;
FT                   cd04867"
FT                   /db_xref="CDD:133440"
FT                   /locus_tag="Acfer_0140"
FT   gene            164877..165650
FT                   /db_xref="GeneID:8736578"
FT                   /locus_tag="Acfer_0141"
FT   CDS_pept        164877..165650
FT                   /locus_tag="Acfer_0141"
FT                   /gene_family="HOG000244025" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.15"
FT                   /transl_table="11"
FT                   /note="KEGG: ctc:CTC01046 histidinol-phosphatase; TIGRFAM:
FT                   histidinol phosphate phosphatase HisJ family; PFAM: PHP
FT                   domain protein"
FT                   /db_xref="GI:284047525"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="GeneID:8736578"
FT                   /translation="MLFDTHTHADYSCDAEQTIGEAAAAAKARGIGIILTEHWDRYYPT
FT                   NPEMFLFDIDDYFKKDGPFRSDRVLLGIEVGLQPRAIEEDRKMVQAHPFDEVVGSMHCF
FT                   DGLDMYEPTTYDGLTKDQAVRRYLEDSVRCLERKPDFDSYGHIDYISRYMPYPDPNLYY
FT                   EDHPELWDRVFRLLIAGDKALEINTRRLGDDSTIPPLMKLYKRFRELGGKYATLGSDAH
FT                   YKEHVGRDFAKGKQIADEAGLTLVYYKDRKRMLCE"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /protein_id="YP_003397864.1"
FT   misc_feature    164880..165632
FT                   /note="histidinol-phosphatase; Provisional; Region:
FT                   PRK05588"
FT                   /db_xref="CDD:168114"
FT                   /locus_tag="Acfer_0141"
FT   misc_feature    <165087..165635
FT                   /note="DNA polymerase alpha chain like domain; Region:
FT                   POLIIIAc; cl02625"
FT                   /db_xref="CDD:174726"
FT                   /locus_tag="Acfer_0141"
FT   gene            165816..166427
FT                   /db_xref="GeneID:8736579"
FT                   /locus_tag="Acfer_0142"
FT   CDS_pept        165816..166427
FT                   /locus_tag="Acfer_0142"
FT                   /gene_family="HOG000262779" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.18"
FT                   /transl_table="11"
FT                   /note="KEGG: rha:RHA1_ro01297 nicotinic acid mononucleotide
FT                   adenylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain protein; PFAM: cytidylyltransferase"
FT                   /db_xref="GI:284047526"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="GeneID:8736579"
FT                   /translation="MGRQRLGILGGTFDPIHNGHLMIARAMLDKLGLDRILFIPDYIPP
FT                   HKRGWHCSPSADRLAMTILAAAEDPRYTVSPMELDRGGVSYTCDTLRQLYRKWHRFYDL
FT                   YFIIGADSAEQLPTWHHIREAMTYATFAAAARPGFAPHKEKVSEELARQGLRNLVWVET
FT                   PELDISSTAIRERIRKGEPVDTMIPKAVAEYIEQRDLYRQ"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /protein_id="YP_003397865.1"
FT   misc_feature    165822..166424
FT                   /note="nicotinic acid mononucleotide adenylyltransferase;
FT                   Provisional; Region: nadD; PRK00071"
FT                   /db_xref="CDD:166763"
FT                   /locus_tag="Acfer_0142"
FT   misc_feature    165831..166418
FT                   /note="Nicotinamide/nicotinate mononucleotide
FT                   adenylyltransferase; Region: NMNAT; cd02165"
FT                   /db_xref="CDD:173916"
FT                   /locus_tag="Acfer_0142"
FT   misc_feature    order(165840..165854,165864..165866,165870..165875,
FT                   165882..165884,165945..165947,166068..166076,
FT                   166131..166133,166137..166142,166146..166151,
FT                   166170..166175,166218..166223,166317..166319)
FT                   /note="active site"
FT                   /db_xref="CDD:173916"
FT                   /locus_tag="Acfer_0142"
FT   misc_feature    order(165843..165845,166071..166076,166167..166172)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173916"
FT                   /locus_tag="Acfer_0142"
FT   gene            166463..167050
FT                   /db_xref="GeneID:8736580"
FT                   /locus_tag="Acfer_0143"
FT   CDS_pept        166463..167050
FT                   /locus_tag="Acfer_0143"
FT                   /gene_family="HOG000016164" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0074 hypothetical protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="GI:284047527"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="GeneID:8736580"
FT                   /translation="MEFKEMQERLEKELPAKRFHHTLAVSETAVKLARRYGVDEKKAAI
FT                   AGLLHDSGRQIPTKEFIAKAAELGIPLDEVEKNQPILIHAKLGVYYAQQEFGVTDPDIL
FT                   SSIRYHTTGAAHMSPLAMVIYLADLVEPNRDFPGVDTMREEVKKGLENGMRKAYAHTME
FT                   YLLDQGLLIHPDCLAGYNELVLKQKEKQNGQE"
FT                   /protein_id="YP_003397866.1"
FT   misc_feature    166463..167026
FT                   /note="Predicted HD superfamily hydrolase involved in NAD
FT                   metabolism [Coenzyme metabolism]; Region: COG1713"
FT                   /db_xref="CDD:31899"
FT                   /locus_tag="Acfer_0143"
FT   misc_feature    166490..166963
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Acfer_0143"
FT   gene            167054..168031
FT                   /db_xref="GeneID:8736581"
FT                   /locus_tag="Acfer_0144"
FT   CDS_pept        167054..168031
FT                   /locus_tag="Acfer_0144"
FT                   /gene_family="HOG000236372" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /codon_start="1"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   chy:CHY_2591 putative transcriptional regulator"
FT                   /db_xref="GI:284047528"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="GeneID:8736581"
FT                   /translation="MTDQKKQGPRRYKKRLRKGRAFFSLVMILFLMASCFAAGMRIYNR
FT                   FFRPRAQVADSQQESLTTEGFSNRINVLLLGTDDGDSDDFDKDVPKRTDAMLLVSFDPE
FT                   NSQVSVLSLPRDTRVTIPGRRGHDKINAAYAYGGVPLAKRTVANLLQVPINHYMQVDWQ
FT                   GFIKVVDMLGGVDLDVEQNMDYEDPYADLKIHLEKGKQHLNGEKAGEYVRFRHDEMGDI
FT                   GRVERQQKFMKALAKQAFTVGNMVKLPVIIGTASEYVKTDMTFIQLVKAANCLRLFGEG
FT                   GVKSASLKGDFGDIGGVSYWVTTPSKIAATLDELKIPHRRIPSI"
FT                   /protein_id="YP_003397867.1"
FT   misc_feature    <167324..168001
FT                   /note="Cell envelope-related transcriptional attenuator
FT                   domain; Region: LytR_cpsA_psr; cl00581"
FT                   /db_xref="CDD:174294"
FT                   /locus_tag="Acfer_0144"
FT   gene            168093..168446
FT                   /db_xref="GeneID:8736582"
FT                   /locus_tag="Acfer_0145"
FT   CDS_pept        168093..168446
FT                   /locus_tag="Acfer_0145"
FT                   /gene_family="HOG000016052" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00090"
FT                   /codon_start="1"
FT                   /product="iojap-like protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: cce:Ccel_1366 iojap-like protein"
FT                   /db_xref="GI:284047529"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="GeneID:8736582"
FT                   /translation="MTGKELANKIAAAAADKKARDILLLNMEGLSSVTDYFMICSAPST
FT                   TQVRAIADGIEDKLAQEGKLPAHKEGYSEGNWVLLDYGDCVAHVFQESQRNFYNLEQLW
FT                   ADAPSESYTETEA"
FT                   /protein_id="YP_003397868.1"
FT   misc_feature    <168168..168404
FT                   /note="Domain of unknown function DUF143; Region: DUF143;
FT                   cl00519"
FT                   /db_xref="CDD:174259"
FT                   /locus_tag="Acfer_0145"
FT   gene            168443..169336
FT                   /db_xref="GeneID:8736583"
FT                   /locus_tag="Acfer_0146"
FT   CDS_pept        168443..169336
FT                   /locus_tag="Acfer_0146"
FT                   /gene_family="HOG000279524" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:NT01CX_0180"
FT                   /codon_start="1"
FT                   /product="S1 RNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0180 S1 RNA-binding domain-
FT                   containing protein"
FT                   /db_xref="GI:284047530"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="GeneID:8736583"
FT                   /translation="MRKERGPVTVKTVGRYRVGDVCEMTVARLGEVGAFLDAGTGNTSD
FT                   DILLHQHQQTSPVKVGDKVKVYLYLDAKGRMTASMKLPKMREGQLGYVKVLSVTRQGGF
FT                   VDIGAERGVFLPYSEMRGHVSPGQLVWVKLYRDKSGRQAVTMRVEEDMVRASVPAEDVK
FT                   VGDELTGTVYNILPEGFFLLTTQRYLAFIHRSEVPSGRLDFGQKVTGRVTFVREDGRVD
FT                   MSLREVKEKAMITDSERILALLEKRQGTMPYSDATPPEIIKDAFGISKAAFKRALGKLM
FT                   KEGKITQENGWTSLVK"
FT                   /protein_id="YP_003397869.1"
FT   misc_feature    168491..169333
FT                   /note="Predicted RNA-bindining protein (contains S1 and HTH
FT                   domains) [General function prediction only]; Region:
FT                   COG2996"
FT                   /db_xref="CDD:32815"
FT                   /locus_tag="Acfer_0146"
FT   misc_feature    168929..169120
FT                   /note="S1_like: Ribosomal protein S1-like RNA-binding
FT                   domain. Found in a wide variety of RNA-associated proteins.
FT                   Originally identified in S1 ribosomal protein. This
FT                   superfamily also contains the Cold Shock Domain (CSD),
FT                   which is a homolog of the S1 domain...; Region: S1_like;
FT                   cl09927"
FT                   /db_xref="CDD:175045"
FT                   /locus_tag="Acfer_0146"
FT   gene            169459..169534
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:8736584"
FT                   /locus_tag="Acfer_R0008"
FT   tRNA            169459..169534
FT                   /db_xref="GeneID:8736584"
FT                   /locus_tag="Acfer_R0008"
FT                   /product="tRNA-Ala"
FT   gene            complement(169896..170894)
FT                   /db_xref="GeneID:8736585"
FT                   /locus_tag="Acfer_0147"
FT   CDS_pept        complement(169896..170894)
FT                   /locus_tag="Acfer_0147"
FT                   /gene_family="HOG000023133" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   afl:Aflv_2103 transposase"
FT                   /db_xref="GI:284047531"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="GeneID:8736585"
FT                   /translation="MNDSSCVFEIIEKTVSTSENRLSISSLCKMAGVSRSGYYAWVKAE
FT                   AFRQAQEEQDRKDFELILAAYKRRGYKKDARSIYMELLHMDPPVIMNVKKIRRLMKKFH
FT                   LLCPIRKANPYRQLAKALKTNTVADNLLQRQFEDYGPRMVLLTDITYLPYNGIFAYLST
FT                   ILDAYTKQILAYVLSDSLEVDFVVETVNNLIRDHGVSLHAETIVHSDQGCHYTSHSFID
FT                   ILHDKDLRQSMSRRGNCWDNAPQESFFGRMKDHVKKKIAAAVSFGEVKAIVDDYMDYYN
FT                   NERYQWELAKLSPNEFYQFVTTGVYPLDIPKMPEVPTLKRRACELGNQLTS"
FT                   /protein_id="YP_003397870.1"
FT   misc_feature    complement(170007..170801)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="Acfer_0147"
FT   misc_feature    complement(170127..170474)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Acfer_0147"
FT   gene            complement(170906..171310)
FT                   /db_xref="GeneID:8736586"
FT                   /locus_tag="Acfer_0148"
FT   CDS_pept        complement(170906..171310)
FT                   /locus_tag="Acfer_0148"
FT                   /gene_family="HOG000292948" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcer98_3736"
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: bcy:Bcer98_3736 putative transposase"
FT                   /db_xref="GI:284047532"
FT                   /db_xref="GeneID:8736586"
FT                   /translation="MSRKLFTEEQIAALRQNPYVYSVSRSTLVLRKSFKEIFYTEYMEG
FT                   VYPKDVFKKYGFDPAVLGERRIGGALQHIKEEYAKYGCFYEGRRPADRSDTAAKVKPED
FT                   DIKALRHEVEYLRQEVEYLKKISAIKNTKR"
FT                   /protein_id="YP_003397871.1"
FT   gene            complement(171676..172746)
FT                   /db_xref="GeneID:8736587"
FT                   /locus_tag="Acfer_0149"
FT   CDS_pept        complement(171676..172746)
FT                   /locus_tag="Acfer_0149"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /codon_start="1"
FT                   /product="membrane protein AbrB duplication"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: gka:GK1526
FT                   hypothetical protein"
FT                   /db_xref="GI:284047533"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="GeneID:8736587"
FT                   /translation="MKRFTAFLAAALAGFLLRQLSVPIPYMLGGIAVGFLLRTFLDNTF
FT                   FWPRSWRGLMLGVAGYGIGSNCTPDTFFKLSQETLGTLGASLFTLAVSVAVAVYMHRHT
FT                   FANLLSSIMGCLPGGLTAMTVLMDDYEEADENVVVVSQCLRLFVVEISVPLLAINLFGG
FT                   QVTRLAGVGLWDASRADFLSLFHPGWLLVVPVVLVGQTLAKKIHMPTGQLLGPIMITAL
FT                   LALWMGRVPRVPAPAMAFAQLHIGLYIGTMLDREKLLKTRALIPNVLLGSLLMVASSAG
FT                   LSLLLSRLYGFTTLTAFLALAPGGIAEMCLTGLEMHQDVAVILTYQLVRVLMLAMGVPF
FT                   VIRKFFKPSGEKKQGV"
FT                   /protein_id="YP_003397872.1"
FT   misc_feature    complement(171694..172689)
FT                   /note="Putative ammonia monooxygenase [General function
FT                   prediction only]; Region: AbrB; COG3180"
FT                   /db_xref="CDD:32993"
FT                   /locus_tag="Acfer_0149"
FT   misc_feature    complement(172276..172683)
FT                   /note="membrane protein AbrB duplication; Region:
FT                   Gneg_AbrB_dup; TIGR03082"
FT                   /db_xref="CDD:163128"
FT                   /locus_tag="Acfer_0149"
FT   misc_feature    complement(171712..172143)
FT                   /note="membrane protein AbrB duplication; Region:
FT                   Gneg_AbrB_dup; TIGR03082"
FT                   /db_xref="CDD:163128"
FT                   /locus_tag="Acfer_0149"
FT   gene            172887..173816
FT                   /db_xref="GeneID:8736588"
FT                   /locus_tag="Acfer_0150"
FT   CDS_pept        172887..173816
FT                   /locus_tag="Acfer_0150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: cac:CAC3361 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:284047534"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736588"
FT                   /translation="MFHEKYLRDFLTVCETGNITAAAARLGLSQPALSRIVKMVEKEAG
FT                   MPLLVREASGVYLTQAGEIYARMARTMLESYRNGLREIHDIRDSQSGQIRLGLSRISSE
FT                   TLLPVILEQFRTLYPHVELHLTETLIRQLNPLLRQGKLDLALTYFTDDPELEYARLLTD
FT                   TVYLEAPPFFWQKQPRWKPGTGNCLENVRLLQNQPFILLKPGRGLRYKADQFFREAGIR
FT                   PRIILETDSVELAHRLAQDNHGFTLIPGLAFRTLHRTERSVFFQVAGHPLDRTLYLVRR
FT                   KGAYLTRAMEALSTLIRSRVTGTGSMVK"
FT                   /protein_id="YP_003397873.1"
FT   misc_feature    172899..173786
FT                   /note="DNA-binding transcriptional regulator CynR;
FT                   Provisional; Region: PRK11242"
FT                   /db_xref="CDD:171037"
FT                   /locus_tag="Acfer_0150"
FT   misc_feature    172905..173075
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0150"
FT   misc_feature    173166..173777
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0150"
FT   misc_feature    order(173208..173213,173217..173222,173229..173231,
FT                   173241..173243,173247..173267,173562..173579,
FT                   173595..173600,173604..173609)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0150"
FT   gene            173841..175247
FT                   /db_xref="GeneID:8736589"
FT                   /locus_tag="Acfer_0151"
FT   CDS_pept        173841..175247
FT                   /locus_tag="Acfer_0151"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07656"
FT                   /codon_start="1"
FT                   /product="KWG repeat protein"
FT                   /transl_table="11"
FT                   /note="PFAM: KWG Leptospira repeat protein; KEGG:
FT                   ate:Athe_0718 KWG Leptospira repeat protein"
FT                   /db_xref="GI:284047535"
FT                   /db_xref="InterPro:IPR011647"
FT                   /db_xref="GeneID:8736589"
FT                   /translation="MNRKQMALLLGLSLALGQTAFAADHVAVVEKNGKQGVIDQGGKEI
FT                   LPLAYKKILVGDPKEDPVILVQQKGRYGLYDRDGKQLLAPTLKKITDINEGIIGGVAEK
FT                   KWNFYTLQGEKLPGEYDEARAFQEGLAAVKLQGKWGFADKTGKVVIQPQYKEVHSFSEG
FT                   LAAVKKDSQWFYIRKDGTLLPTVSVRKAGDFHQGVAVVDGSWLMDTQGKKYAKLKSYSF
FT                   VGDFQENGLAEVGVRRASRSLLDYISIGWGWGDGWGWGGPVWGVGPGWGPYWGGYGYHH
FT                   HHHHHGWGGGIGISPGVVMPSSLYRGYVNKKAQEVISPTYSYVSPFYGKLALIREDGHW
FT                   GMVDTKGQVVIPAAYDALLPFSEGLAAFGSDKKWGFIDESNKVVIPNRFDSVQSFFQDR
FT                   TTAVEKDKGGIIDKAGNPVAPFRGELRELGPLTADRAAYRDPEKKKWGYVDENAKTVIS
FT                   PQYDKAGIFD"
FT                   /protein_id="YP_003397874.1"
FT   gene            175571..176836
FT                   /db_xref="GeneID:8736590"
FT                   /locus_tag="Acfer_0152"
FT   CDS_pept        175571..176836
FT                   /locus_tag="Acfer_0152"
FT                   /gene_family="HOG000226971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /codon_start="1"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: aconitate hydratase domain
FT                   protein; KEGG: ckl:CKL_2159 3-isopropylmalate dehydratase
FT                   large subunit"
FT                   /db_xref="GI:284047536"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="GeneID:8736590"
FT                   /translation="MGMTRTQKILARHAGRPEVEEGELLVSQVDLTLANDITGPPAIDE
FT                   FDKIGRPVFNKDKIALVPDHFSPPKDIKSATLCKHMRDFARKHNITNYFEVGRMGIEHA
FT                   LVPDSGLVAPGELVIGADSHTCTYGAVNAFSTGVGQTDLGAAMASGQTWFKVPKAIKVV
FT                   LTGKKPDYISGKDVILTLIGMIGVDGALYQSLEFFGEGVGELSMADRFTICNMAIEAGG
FT                   KNGIFPVDDKTREYLKERGVTRPWEAVEADEDAVYARTITIELDKLVPVVAYPHLPENT
FT                   HPAAEGKDLAIDQVVIGSCTNGRYEDLVSAARILKGRKVDPRVRCIIIPATQEIYKRAM
FT                   DNGLLDIFIEAGAAVSTPTCGPCLGGYMGILAAGERCVSTTNRNFRGRMGHVDSEVYLA
FT                   SPLTAAASAVTGHITDPREVLK"
FT                   /protein_id="YP_003397875.1"
FT   misc_feature    175571..176830
FT                   /note="3-isopropylmalate dehydratase large subunit;
FT                   Reviewed; Region: PRK00402"
FT                   /db_xref="CDD:166941"
FT                   /locus_tag="Acfer_0152"
FT   misc_feature    175661..176809
FT                   /note="3-isopropylmalate dehydratase catalyzes the
FT                   isomerization between 2-isopropylmalate and
FT                   3-isopropylmalate; Region: IPMI; cd01583"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Acfer_0152"
FT   misc_feature    order(175673..175675,175682..175684,175934..175939,
FT                   176660..176662,176717..176719,176732..176734)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Acfer_0152"
FT   misc_feature    order(175940..175942,176468..176470,176648..176650,
FT                   176657..176662,176714..176716)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Acfer_0152"
FT   gene            176833..177315
FT                   /db_xref="GeneID:8736591"
FT                   /locus_tag="Acfer_0153"
FT   CDS_pept        176833..177315
FT                   /locus_tag="Acfer_0153"
FT                   /gene_family="HOG000222940" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /codon_start="1"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   pab:PAB0892 3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="GI:284047537"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="GeneID:8736591"
FT                   /translation="MSKVWRYGDHVDTDVIIPARYLNISDFKELSEHAMEDIDTTFAPN
FT                   VKPGDIIVAGRNFGCGSSREHAPIVIQQKGVACIIAESFARIFYRNAINIGLPVLEIGE
FT                   EAKKIQAGDQVEVDFDKGEIRVVNKGLVIKTHPLPAFVRKIAEAGGLINYVKGVHA"
FT                   /protein_id="YP_003397876.1"
FT   misc_feature    176848..177189
FT                   /note="Aconatase-like swivel domain of 3-isopropylmalate
FT                   dehydratase and related uncharacterized proteins.
FT                   3-isopropylmalate dehydratase catalyzes the isomerization
FT                   between 2-isopropylmalate and 3-isopropylmalate, via the
FT                   formation of 2-isopropylmaleate 3...; Region: IPMI_Swivel;
FT                   cd01577"
FT                   /db_xref="CDD:73275"
FT                   /locus_tag="Acfer_0153"
FT   misc_feature    177016..177024
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73275"
FT                   /locus_tag="Acfer_0153"
FT   gene            177315..178388
FT                   /db_xref="GeneID:8736592"
FT                   /locus_tag="Acfer_0154"
FT   CDS_pept        177315..178388
FT                   /locus_tag="Acfer_0154"
FT                   /gene_family="HOG000021112" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.85"
FT                   /transl_table="11"
FT                   /note="KEGG: aae:aq_244 3-isopropylmalate dehydrogenase;
FT                   TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="GI:284047538"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="GeneID:8736592"
FT                   /translation="MKVTVLAGDGIGPEITDAALVVLKKTADVFGLDISYDHKLMGGCA
FT                   YDRFGTPLPEETIASAKAADGVLLGAVGGPKWDHIEDVTKRPEKGLLGIRKALGLYCNL
FT                   RPVQVRPYMAHLSPLKTERVEGADLVIVRELTGGIYFGEHREAALVDGVETASDVEKYT
FT                   RPEVERIAVKAFEAARLRRGKVTSVDKANVLGASRMWRKIVEEIHDAHYPDVELNHFYV
FT                   DNCAMQLVLNPKQFDVILTNNIFGDILSDEASTIAGSIGLLPSASLGDGTGLYEPIHGS
FT                   APDIAGKDIANPLGTILSAAMLLRYSLYQEEAARAIERAVDDVMKAGYRTPDLAGEGLT
FT                   TVGTKKMGQLVAEAVRK"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /protein_id="YP_003397877.1"
FT   misc_feature    177315..178385
FT                   /note="Isocitrate/isopropylmalate dehydrogenase; Region:
FT                   Iso_dh; cl00445"
FT                   /db_xref="CDD:174206"
FT                   /locus_tag="Acfer_0154"
FT   misc_feature    177336..178358
FT                   /note="isocitrate dehydrogenase; Validated; Region:
FT                   PRK06451"
FT                   /db_xref="CDD:168554"
FT                   /locus_tag="Acfer_0154"
FT   gene            178476..179045
FT                   /db_xref="GeneID:8736593"
FT                   /locus_tag="Acfer_0155"
FT   CDS_pept        178476..179045
FT                   /locus_tag="Acfer_0155"
FT                   /gene_family="HOG000220753" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /codon_start="1"
FT                   /EC_number="3.2.2.20"
FT                   /transl_table="11"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: blj:BLD_0730
FT                   3-methyladenine DNA glycosylase"
FT                   /db_xref="GI:284047539"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="GeneID:8736593"
FT                   /translation="MTQWADGKQRCFWANPGNPRYIRYHDEEWGRPVHEDRKLFEMLLL
FT                   ETFQAGLSWECVLNKREGFRRAFDGFDPEIIAGYTEEKLEALGQDPAIIRNRLKIRAAV
FT                   TNARVFLAIRREWSTFDRYLWHWTEGKTLRETDLTHSPLSDAISKDLKKWGMKFVGTIV
FT                   IYSLLQAVGIIWSHEKGCFLEREKGK"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /protein_id="YP_003397878.1"
FT   misc_feature    178512..179021
FT                   /note="Methyladenine glycosylase; Region: Adenine_glyco;
FT                   cl01059"
FT                   /db_xref="CDD:174509"
FT                   /locus_tag="Acfer_0155"
FT   gene            complement(179327..179830)
FT                   /db_xref="GeneID:8736594"
FT                   /locus_tag="Acfer_0156"
FT   CDS_pept        complement(179327..179830)
FT                   /locus_tag="Acfer_0156"
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, small subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein; KEGG: dhd:Dhaf_3616
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="GI:284047540"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="GeneID:8736594"
FT                   /translation="MIRQHLAILADNKPGVLTHVAGLISRRAINIEFINAGYTEERDVT
FT                   RINIVVSVEDRYELDQAIKQLAKLIDVIKVVNLDDAPFVSYELAMIKVSAPTPQVREEV
FT                   ASLAELFHAKVVDVQKKSLVLRLTGREDHIDALLEVLEDYEIIEIARTGQISLSRGLVP
FT                   VKKM"
FT                   /protein_id="YP_003397879.1"
FT   misc_feature    complement(179351..179815)
FT                   /note="acetolactate synthase 3 regulatory subunit;
FT                   Reviewed; Region: ilvH; PRK11895"
FT                   /db_xref="CDD:171329"
FT                   /locus_tag="Acfer_0156"
FT   misc_feature    complement(179603..179815)
FT                   /note="N-terminal ACT domain of the Escherichia coli
FT                   IlvH-like regulatory subunit of acetohydroxyacid synthase
FT                   (AHAS); Region: ACT_AHAS; cd04878"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0156"
FT   misc_feature    complement(order(179696..179698,179723..179725,
FT                   179738..179743,179780..179782,179795..179797,
FT                   179801..179803))
FT                   /note="putative valine binding site; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0156"
FT   misc_feature    complement(order(179693..179695,179723..179737,
FT                   179747..179749,179756..179758,179777..179779,
FT                   179786..179791))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0156"
FT   misc_feature    complement(179351..179572)
FT                   /note="Small subunit of acetolactate synthase; Region:
FT                   ALS_ss_C; pfam10369"
FT                   /db_xref="CDD:150959"
FT                   /locus_tag="Acfer_0156"
FT   gene            complement(179827..181524)
FT                   /db_xref="GeneID:8736595"
FT                   /locus_tag="Acfer_0157"
FT   CDS_pept        complement(179827..181524)
FT                   /locus_tag="Acfer_0157"
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: dhd:Dhaf_3617 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="GI:284047541"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="GeneID:8736595"
FT                   /translation="MKITGAEAVIESLRKEQVQVVFGYPGGAVLSLYDALYRMKFPHIL
FT                   TGHEQGAVHAADGYARATGQVGVCFATSGPGVCNMVTGIATANMDSIPLVVISGQVATP
FT                   LIGRDSFQEADISGITTPITKHNYLVKRVQDLPRVLKEAFYIARSGRPGPVLVDVAKDV
FT                   FDTPFDYEYPETVSLRGYQPLQEGREAEVSAALAALRQARRPLLMVGGGVVLSDTAEPL
FT                   RQIVRDASLPVVYTLMGKGAIPDDWEENLGMAGMHGTWTANMAITQCDLLLTVGARFDD
FT                   RVTGSVANFAPKARIVHFDIDQVEINKIVHADLSVNGDLRWSLPAFRKQLEASPIPAVQ
FT                   TVTWRQELQEMKAGHPAGTRPSSEKGLSPQVVLEETAKKAGPEALVATDVGQHQMWAAQ
FT                   FYPVSQPHHFITSGGLGTMGYGLPAALGAQLGEPDKPVVLITGDGSIMMNCQEFATLHK
FT                   YGIAVKTVVLRNNTLGMVHQWQGMFYKGHFAESDLTANPSIAGVARSMGVPAWTVEKEE
FT                   ELPAALDRLFAQEGPALLEVTIPPDENVYPMVPGGKKLDEMVTGGDNA"
FT                   /protein_id="YP_003397880.1"
FT   misc_feature    complement(179848..181518)
FT                   /note="acetolactate synthase, large subunit, biosynthetic
FT                   type; Region: acolac_lg; TIGR00118"
FT                   /db_xref="CDD:161717"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(181042..181506)
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(order(181255..181260,181267..181269,
FT                   181279..181281,181300..181302,181336..181344,
FT                   181348..181353,181360..181365,181372..181374,
FT                   181381..181401,181423..181425,181435..181437,
FT                   181447..181452,181465..181467))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(order(181159..181161,181168..181170,
FT                   181270..181272,181279..181284,181288..181293,
FT                   181300..181302,181375..181377,181381..181392,
FT                   181396..181398,181423..181425,181435..181437,
FT                   181444..181452))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(order(181288..181290,181300..181302,
FT                   181378..181380,181450..181452))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(180547..180903)
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(179869..180426)
FT                   /note="Thiamine pyrophosphate (TPP) family,
FT                   Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
FT                   module; composed of proteins similar to the large catalytic
FT                   subunit of AHAS. AHAS catalyzes the condensation of two
FT                   molecules of pyruvate to give the...; Region: TPP_AHAS;
FT                   cd02015"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(order(180115..180117,180181..180183,
FT                   180190..180198,180271..180273,180277..180279,
FT                   180346..180357))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0157"
FT   misc_feature    complement(order(180010..180012,180019..180021,
FT                   180031..180036,180151..180153,180172..180177,
FT                   180181..180186,180271..180273,180277..180279,
FT                   180286..180288))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0157"
FT   gene            complement(181646..182656)
FT                   /db_xref="GeneID:8736596"
FT                   /locus_tag="Acfer_0158"
FT   CDS_pept        complement(181646..182656)
FT                   /locus_tag="Acfer_0158"
FT                   /gene_family="HOG000016230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.86"
FT                   /transl_table="11"
FT                   /note="KEGG: ava:Ava_0133 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="GI:284047542"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736596"
FT                   /translation="MAKVFYDKDVNWSVLKDKTVAIIGYGSQGHAHALNLKESGVNVVV
FT                   GLYKGSKSADVARAAGLEVKTVAEAVAAADVTMVLIPDEKQADVYKAEIAPNLKSGSAL
FT                   AFAHGFNIHFKQIVPPADVDVFMVAPKGPGHLVRRTFVEGGGVPDVFAVEQDATGKCFD
FT                   LALAYARGIGGTRAGVIQTTFQEETETDLFGEQAVLCGGICQLITNGFETLCEAGYQPE
FT                   IAYFETFHEMKLIVDLMYEGGMAKMRKSISDTAEYGDYTAGPKVVTQDSKAAMKQVLSD
FT                   IQDGTFAKDWLLENRAGGRAHFLAMRRQHAEHPIEKVGEKLRSMMPWLHENDKNE"
FT                   /product="ketol-acid reductoisomerase"
FT                   /protein_id="YP_003397881.1"
FT   misc_feature    complement(181670..182656)
FT                   /note="ketol-acid reductoisomerase; Provisional; Region:
FT                   PRK05479"
FT                   /db_xref="CDD:168079"
FT                   /locus_tag="Acfer_0158"
FT   misc_feature    complement(182123..182617)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Acfer_0158"
FT   misc_feature    complement(181670..182107)
FT                   /note="Acetohydroxy acid isomeroreductase, catalytic
FT                   domain; Region: IlvC; pfam01450"
FT                   /db_xref="CDD:110451"
FT                   /locus_tag="Acfer_0158"
FT   gene            complement(183117..183803)
FT                   /db_xref="GeneID:8736597"
FT                   /locus_tag="Acfer_0159"
FT   CDS_pept        complement(183117..183803)
FT                   /locus_tag="Acfer_0159"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: chy:CHY_0092 DNA-binding response
FT                   regulator"
FT                   /db_xref="GI:284047543"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:8736597"
FT                   /translation="MEKILIVEDDLDIAELERDYLEANGFAVAIAGDGLAGEKAALDEK
FT                   VDLVLLDIMLPGMDGFQVCRRIREKRNIPILLVSARQEDVDKIRGLGLGADDYIVKPFS
FT                   PGELVARVKAHLQRYRQLTGQHSGDQLLRRKDLTIDRKGHHVYLKGKEIAMPNKEFSLL
FT                   LFLAENPGVVFSKETLFERIWGEDSLGDTATVSVHVNRIREKIEPSTAKPEYIETVWGV
FT                   GYRFRK"
FT                   /protein_id="YP_003397882.1"
FT   misc_feature    complement(183123..183797)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(183456..183791)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(order(183498..183503,183510..183512,
FT                   183567..183569,183624..183626,183648..183650,
FT                   183777..183782))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(183648..183650)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(order(183624..183632,183636..183641))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(183495..183503)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(183126..183410)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0159"
FT   misc_feature    complement(order(183135..183137,183150..183152,
FT                   183186..183191,183213..183215,183222..183224,
FT                   183276..183281,183336..183338))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="Acfer_0159"
FT   gene            complement(183775..185286)
FT                   /db_xref="GeneID:8736598"
FT                   /locus_tag="Acfer_0160"
FT   CDS_pept        complement(183775..185286)
FT                   /locus_tag="Acfer_0160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   cbe:Cbei_2920 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="GI:284047544"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="GeneID:8736598"
FT                   /translation="MRWKDLPIRKRLLAANYLMILMPVLCFALLSLGIFWIFGLENLNR
FT                   SSIISFIWPESGPNLTIQFELTRLRVRSDHFEPDNPHPLMRVTEHLEDQGLRVVLEQHG
FT                   HPFYTTKGQQPDEIRTTALQQVPEGQGGISWGKKGLAFHYRSLQTGVEAWVTGPDPLVE
FT                   GDDLFTLHSKELFKGSFIGAFLLVLLAAALVGLLLSRLMARQLLKPLGKLRRVAAQVSR
FT                   GDLDTPIRADSRDEIGDTLRAFEKSRLELCRARQKREQDERSRKEMLAGIAHDLATPLT
FT                   KIQGYAAGIQDGIADTPEKRQRYLQKILETTENMAKLNQTLFLFSKLDLDQVPFHWETV
FT                   DLCSWMRDYVEKQREHWEQNGLHLTFSTALTAAPIRMDRDQFARVLENLLGNSWKYKTE
FT                   KAGTLAIALKPQGKNQVRLELADDGPGVAPEQLDRIFESFYRTDRARSHVSAGSGLGLA
FT                   VVRKITTTMKGTIRAEANQPHGLKICMTFPLEEDLNNGKNPDRGR"
FT                   /protein_id="YP_003397883.1"
FT   misc_feature    complement(184534..184665)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(order(184534..184539,184546..184551,
FT                   184555..184560,184567..184572,184576..184581,
FT                   184627..184629,184633..184638,184645..184650,
FT                   184654..184659))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(184306..184503)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(order(184321..184323,184333..184335,
FT                   184342..184344,184354..184356,184363..184365,
FT                   184375..184377,184429..184431,184438..184440,
FT                   184450..184452,184459..184461,184471..184473,
FT                   184483..184485))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(184465..184467)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(183826..184143)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(order(183838..183840,183844..183849,
FT                   183862..183864,183868..183870,183916..183927,
FT                   184006..184011,184015..184017,184021..184023,
FT                   184027..184029,184102..184104,184111..184113,
FT                   184123..184125))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(184111..184113)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0160"
FT   misc_feature    complement(order(183919..183921,183925..183927,
FT                   184009..184011,184015..184017))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Acfer_0160"
FT   gene            186056..187753
FT                   /db_xref="GeneID:8736599"
FT                   /locus_tag="Acfer_0161"
FT   CDS_pept        186056..187753
FT                   /locus_tag="Acfer_0161"
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP- binding; KEGG: dhd:Dhaf_3617 acetolactate
FT                   synthase, large subunit, biosynthetic type"
FT                   /db_xref="GI:284047545"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="GeneID:8736599"
FT                   /translation="MEMTGAEAILACLKAEQVPVVFGYPGGAVLGLYDAIYKTHFPHIL
FT                   TGHEQGAIHAADGYARATGKVGVCIATSGPGVCNMVTGIATANMDSIPLVIISGQVATS
FT                   LIGQDAFQEADTAGITTPITKYNYLVRKVGNLPQVLKEAFYIARTGRPGPVLIDIVTDV
FT                   FDARLDFQYPNEVHLLGYQGSQHARQADVQRAAEALRRARRPVIMAGGGVILSETAGEL
FT                   TALAEKTGIPVVTTLMGKGAVPDSLPQNLGMLGMHGSYAANMAVSGCDLLLAFGVRFDE
FT                   RSTAKAGLFAPAARIVHFNVEPGEINKIIPVQVAVPGDLKESLPLFSQLVEPLAEEFRE
FT                   QVAPWREQAEEMKAEIPCSAHACQGGISPEIALKQAAARAPRDTIVVTDVGQHQMWAAQ
FT                   FFPTEQPRHFLTSGGLGTMGFGLPAALGAKVGEPEKTVLLITGDGSILMNCQEFTTLPT
FT                   YGIQVKTIVLKNGQLGMVRQLQGLFRGGRYSQTKLIRKPSMAKIAEAMGIPSRSISRPE
FT                   ELAEGLDFLFGSEDSALLEITIPEDERVYPVVPGSKGLDQMILGPEEK"
FT                   /protein_id="YP_003397884.1"
FT   misc_feature    186062..187735
FT                   /note="acetolactate synthase, large subunit, biosynthetic
FT                   type; Region: acolac_lg; TIGR00118"
FT                   /db_xref="CDD:161717"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    186074..186532
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    order(186113..186115,186128..186133,186143..186145,
FT                   186155..186157,186179..186199,186206..186208,
FT                   186215..186220,186227..186232,186236..186244,
FT                   186278..186280,186299..186301,186311..186313,
FT                   186320..186325)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    order(186128..186136,186143..186145,186155..186157,
FT                   186182..186184,186188..186199,186203..186205,
FT                   186278..186280,186287..186292,186296..186301,
FT                   186308..186310,186410..186412,186419..186421)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    order(186128..186130,186200..186202,186278..186280,
FT                   186290..186292)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    186668..187027
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    187154..187708
FT                   /note="Thiamine pyrophosphate (TPP) family,
FT                   Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
FT                   module; composed of proteins similar to the large catalytic
FT                   subunit of AHAS. AHAS catalyzes the condensation of two
FT                   molecules of pyruvate to give the...; Region: TPP_AHAS;
FT                   cd02015"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    order(187223..187234,187301..187303,187307..187309,
FT                   187382..187390,187397..187399,187463..187465)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0161"
FT   misc_feature    order(187292..187294,187301..187303,187307..187309,
FT                   187394..187399,187403..187408,187427..187429,
FT                   187544..187549,187559..187561,187568..187570)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="Acfer_0161"
FT   gene            187768..188307
FT                   /db_xref="GeneID:8736600"
FT                   /locus_tag="Acfer_0162"
FT   CDS_pept        187768..188307
FT                   /locus_tag="Acfer_0162"
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, small subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein; KEGG: hmo:HM1_1980
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="GI:284047546"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="GeneID:8736600"
FT                   /translation="MKWQHMALLVNNRPGVLSHVAGLIARRNINIECLNVGYTEIPEIS
FT                   RINLVVGVESRFQLDQAIHQLSHLIDVIKVVNLDDAPLVSYELTLIKVSAPTPQIREEL
FT                   TNIANLFHAKIVDVYPDSLIFRLTGRQDHIQALKQMLQNYEILEIATTGQIALGRGPQT
FT                   VKDSLLTEPETEGEQP"
FT                   /protein_id="YP_003397885.1"
FT   misc_feature    187786..188256
FT                   /note="acetolactate synthase 3 regulatory subunit;
FT                   Reviewed; Region: ilvH; PRK11895"
FT                   /db_xref="CDD:171329"
FT                   /locus_tag="Acfer_0162"
FT   misc_feature    187789..187995
FT                   /note="N-terminal ACT domain of the Escherichia coli
FT                   IlvH-like regulatory subunit of acetohydroxyacid synthase
FT                   (AHAS); Region: ACT_AHAS; cd04878"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0162"
FT   misc_feature    order(187795..187797,187801..187803,187816..187818,
FT                   187855..187860,187873..187875,187900..187902)
FT                   /note="putative valine binding site; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0162"
FT   misc_feature    order(187807..187812,187819..187821,187840..187842,
FT                   187849..187851,187861..187875,187903..187905)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="Acfer_0162"
FT   misc_feature    188026..188247
FT                   /note="Small subunit of acetolactate synthase; Region:
FT                   ALS_ss_C; pfam10369"
FT                   /db_xref="CDD:150959"
FT                   /locus_tag="Acfer_0162"
FT   gene            188304..189557
FT                   /db_xref="GeneID:8736601"
FT                   /locus_tag="Acfer_0163"
FT   CDS_pept        188304..189557
FT                   /locus_tag="Acfer_0163"
FT                   /gene_family="HOG000255906" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05673"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF815"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF815; KEGG:
FT                   cac:CAC3262 ABC transporter ATPase"
FT                   /db_xref="GI:284047547"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="GeneID:8736601"
FT                   /translation="MTQALQTADFRIFATLSVLRDLRRDPVIRNLEKAQAHPEREKHLA
FT                   RAREAVLAAAEELGLAGNLWQGYFFHLLAEGENLAAQVVETRGEAGSGIQAALTRDLEK
FT                   LRPFWELTGRDVFQDGFYDHYEPGHPVRDSLDAQLARQLKETEEAAGKARLLLHHYQRY
FT                   GRGKMARYEAFCLDAKGRFQGIADFPHYAWDDILGYEDQKEKLLANTRQFMAGRGCNNV
FT                   LSTGSRGTGKSTSIKALIPLFSAQGLRLVQIKRDQLQLLAEAMERAGKIRSHRFLFFFD
FT                   DLSFDENEKEYKYLKSAIDGGAAPQPDNVMLCATSNRRHLLKETWVDRSDELEAEVYRE
FT                   DATNESISLSDRFGLILHFGAPSQQEYLAIIDHELRKEGIQLSPEELRVEGVRWEMEHS
FT                   GRNGRIAKQFVQWYLGNH"
FT                   /protein_id="YP_003397886.1"
FT   misc_feature    188700..189554
FT                   /note="Predicted ATPase (AAA+ superfamily) [General
FT                   function prediction only]; Region: COG2607"
FT                   /db_xref="CDD:32599"
FT                   /locus_tag="Acfer_0163"
FT   misc_feature    188808..189548
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0163"
FT   gene            189618..190175
FT                   /db_xref="GeneID:8736602"
FT                   /locus_tag="Acfer_0164"
FT   CDS_pept        189618..190175
FT                   /locus_tag="Acfer_0164"
FT                   /gene_family="HOG000244137" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /codon_start="1"
FT                   /product="methylated-DNA/protein-
FT                   cysteinemethyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: cdf:CD0601
FT                   methylated-DNA--protein-cysteine methyltransferase 1"
FT                   /db_xref="GI:284047548"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="GeneID:8736602"
FT                   /translation="MDETGLYTDRVGTPLGDMIMTSHGEALLGLWFQGERYEPGEQELA
FT                   GARRNPDLPVFQETRRWLELYFQGKDPGFTPPLELSGSVFRQQVGRIMLTIPYGKTMTY
FT                   GAIAREMAGKTGKKQMSAQAVGGAVGHNPISLIIPCHRVVGSSGSLTGYGGGMPRKVWL
FT                   LEHEGIDLKASGFTIPKKGTAL"
FT                   /protein_id="YP_003397887.1"
FT   misc_feature    189633..190124
FT                   /note="Methylated DNA-protein cysteine methyltransferase
FT                   [DNA replication, recombination, and repair]; Region: Ada;
FT                   COG0350"
FT                   /db_xref="CDD:30699"
FT                   /locus_tag="Acfer_0164"
FT   misc_feature    189870..190121
FT                   /note="The DNA repair protein O6-alkylguanine-DNA
FT                   alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
FT                   reverses O6-alkylation DNA damage by transferring O6-alkyl
FT                   adducts to an active site cysteine irreversibly, without
FT                   inducing DNA strand breaks. ATases...; Region: ATase;
FT                   cd06445"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="Acfer_0164"
FT   misc_feature    order(189870..189875,189927..189932,189957..189959,
FT                   189978..189980,189984..189989,189993..189995,
FT                   190002..190007,190011..190013,190035..190037,
FT                   190050..190052,190071..190073)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="Acfer_0164"
FT   misc_feature    order(189927..189929,190035..190040,190044..190046,
FT                   190116..190118)
FT                   /note="active site"
FT                   /db_xref="CDD:119438"
FT                   /locus_tag="Acfer_0164"
FT   gene            complement(190200..191705)
FT                   /db_xref="GeneID:8736603"
FT                   /locus_tag="Acfer_0165"
FT   CDS_pept        complement(190200..191705)
FT                   /locus_tag="Acfer_0165"
FT                   /gene_family="HOG000159796" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 39"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   geo:Geob_1553 glycosyl transferase family 39"
FT                   /db_xref="GI:284047549"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="GeneID:8736603"
FT                   /translation="MEYWENDGSPLLRFYHRHWPALLLLLLSLVLFFAGNSRLLITDPV
FT                   ESNYALTAREMLADGDWLSPRIYGNFWYDKPWLFYGELLIAFRLFGVTSFAARFFPAVF
FT                   ATIGVLQTYWFAQKLYNRKVGFLSGLIMATSVEYFYLAKAVITDMTLFVTTTGSLMLFY
FT                   VAKSENKSRLLYGAYALTGLALLTKGPVGLVLPGLIILAYLAGNRDFHTLTRMKLIRGS
FT                   LLTLGIAALWYGPMIALHGTDFLTGFIGVHNILRATVSEHPRNNTWWYYFLIFLIGCFP
FT                   WSLSLPWLWKKYGHILKERIKTRTFWKNLNDRQRFLFLWAFVTWFFFECMATKYPTYTL
FT                   PYLPPLTIGLACAASRLDLQYWVKRTALAMALLFTVLSFVLAAPLCRQASGWDAARLVT
FT                   ARHAPGVPVYVYGGRYPVSFTYYSGIPAPRLVTRQRIRELRPNGISWKAKNMMPFAALE
FT                   DLPDTGKVMVLVDRSSQKDFLQTVSGKWEKLGEGGRWTVWERK"
FT                   /protein_id="YP_003397888.1"
FT   misc_feature    complement(<190722..191600)
FT                   /note="Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase; Region: PMT; cl01961"
FT                   /db_xref="CDD:174694"
FT                   /locus_tag="Acfer_0165"
FT   gene            191986..193095
FT                   /db_xref="GeneID:8736604"
FT                   /locus_tag="Acfer_0166"
FT   CDS_pept        191986..193095
FT                   /locus_tag="Acfer_0166"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05662"
FT                   /codon_start="1"
FT                   /product="Hemagluttinin domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Haemagluttinin domain protein; YadA domain
FT                   protein; KEGG: msu:MS0748 hypothetical protein"
FT                   /db_xref="GI:284047550"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="GeneID:8736604"
FT                   /translation="MQDVSPAWQSSWGAVSVGAGASQNENGRTIPQRTRQIINLAAGTE
FT                   DTDAVNVAQLKEAMSDARISIHAGEGIIVEKLGTEYTIKANLNGLSNEHGTVHILSDPG
FT                   ELPGTQDGSELRPARAILRAVAEPQTENGGQLHVGYVSNKVDFATDEGPTARLNDGGVV
FT                   KVLGGDNIHTASSSTTNDNGQTVDNIHIHLNKDIRVDSVSIGEKGPILNGEGMDMKGLS
FT                   ITGLAPGEVSATSMDAVNGSQLHATNQMVQENRQNITQLGNSLNKLDARVNRVGAGAAA
FT                   LAALQPLDFDPDDKWDFAAGYGNYAGAHAVAIGAYYRPTEELMFSYINRSCRGGRPGRP
FT                   PNQRLSVCFAGRRACAPYGLCCFKINLPN"
FT                   /protein_id="YP_003397889.1"
FT   misc_feature    192088..192150
FT                   /note="Haemagglutinin; Region: HIM; pfam05662"
FT                   /db_xref="CDD:114389"
FT                   /locus_tag="Acfer_0166"
FT   gene            complement(193161..194282)
FT                   /db_xref="GeneID:8736605"
FT                   /locus_tag="Acfer_0167"
FT   CDS_pept        complement(193161..194282)
FT                   /locus_tag="Acfer_0167"
FT                   /gene_family="HOG000267327" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01717"
FT                   /codon_start="1"
FT                   /product="Methionine synthase vitamin-B12 independent"
FT                   /transl_table="11"
FT                   /note="PFAM: Methionine synthase vitamin-B12 independent;
FT                   KEGG: msu:MS0941 MetE protein"
FT                   /db_xref="GI:284047551"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="GeneID:8736605"
FT                   /translation="MTKNKPPFRYDIVGSFLRPAALKEKREAFAAGTITAADLKAAEDE
FT                   AIRDLVAREKEVGLHAVTDGEFRRRYWHLDFLTELQGVTEISAENWSVHFKGAQPKART
FT                   ARITGLVDFGKHPFLDHFKALQEIAGKDTLVKMTIPSPSMLHLICCVREKHYEPIPQYQ
FT                   DQNRLFTDIALAYQHAIKAFYAAGCRYLQLDDTSWGEFCDADKRKAYAERGFDLDELAR
FT                   HYVEMINRALEAKPDDMTITMHICRGNFRSTWFSSGGYEPVAETLFGRCRVDGFFLEYD
FT                   SDRAGGFEPLRFIKDQQVVLGLVTSKTPELEKEEDIIARIREAEKYVPLDQLCLSPQCG
FT                   FSSTEEGNLLTEKEQWAKLRLIRDIAEKVWKDA"
FT                   /protein_id="YP_003397890.1"
FT   misc_feature    complement(193197..194258)
FT                   /note="C-terminal domain_like. Many members have been
FT                   characterized as
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferases, EC:2.1.1.14, mostly from bacteria and
FT                   plants. This enzyme catalyses the last step in the
FT                   production of methionine by...; Region:
FT                   CIMS_C_terminal_like; cd03311"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Acfer_0167"
FT   misc_feature    complement(order(193263..193268,193545..193547,
FT                   193551..193553,193701..193703,193707..193709,
FT                   194067..194069,194085..194087,194238..194246))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Acfer_0167"
FT   misc_feature    complement(order(193695..193697,193857..193859,
FT                   194004..194012))
FT                   /note="THF binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Acfer_0167"
FT   misc_feature    complement(order(193266..193268,193446..193448,
FT                   193545..193547,193551..193553))
FT                   /note="zinc-binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Acfer_0167"
FT   gene            complement(194529..198815)
FT                   /db_xref="GeneID:8736606"
FT                   /locus_tag="Acfer_0168"
FT   CDS_pept        complement(194529..198815)
FT                   /locus_tag="Acfer_0168"
FT                   /gene_family="HOG000261965" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /codon_start="1"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: Protein of unknown function DUF2229, CoA enzyme
FT                   activase; ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   bth:BT_1407 activator of (R)-2- hydroxyglutaryl-CoA
FT                   dehydratase"
FT                   /db_xref="GI:284047552"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="GeneID:8736606"
FT                   /translation="MSTYRVGLDIGSTTCKIVVLDNHSHVVFSRYKRHQANVAGVLREE
FT                   LKTLRSQIGGASLKLKITGSVGMGVAEKFQIPFEQEVIAATKFVKAKYPDVATLIDIGG
FT                   EDAKIVYIKKDGSCDLRMNGNCAGGTGAFLDQMAVLLGIPIEQLNGLAEKAQHVHYIAS
FT                   RCGVFAKTDIQNLLAKNVSREDIAISIFHAVAVQVISTLSHGCTIEPRILLCGGPLTFM
FT                   PALRKALMDCLQIPYVNFVVPENANLIPAYGTALSAADAPVITFDKLVEKLESAPKVAV
FT                   RSDDILPPIFQSPEDYAAWKKAKEADAIQLTPLTAETDGIYVGIDSGSTTTKLVVTDDQ
FT                   DRILFTHYGPNSGNPIGAVQEAFEAFYAECLKVGANPRILGSCSTGYGEDLIKAAFDLK
FT                   TGIIETIAHYLAARKIHQDVSFILDIGGQDMKAIFVDHGVLNRMELNESCSSGCGTFLE
FT                   TFAKGLNYSVSDFAKLACEAKEPCDLGTRCTVFMNSKVKQSLREGVTIGDISAGLAYSV
FT                   IKNCLYKVLKLQNTHDLGNDIVLQGGTMKNDAVVRAFELLTGTTVHRSNIPEIMGAYGC
FT                   ALFARSRAEGESTLDDMIHVANYTDSQLQCHGCENNCLIKKYNFSNGSVYYSGNKCEKF
FT                   FTNNGEEHKPGENIYDYKYKLLFDRPVKEDAQRIIGIPRCLNIYEDYPFWHALFTTCGL
FT                   KVQLSDPSTFKNYEGGIHDVMSDNICFPAKLVHGHINNLIRKRVNRIFMPYVIYEWQDD
FT                   KRQLNSYNCPVVSGYSDVIKSVVDTEIPIDSPPINFQDESLLKKQIRKYLSYIGFDRFT
FT                   ADKALKAALKAQEEYGRAIKAKNEEILQKSRANKQLTILLAGRPYHTDPLIQHKLSESI
FT                   AAMGINVINEDLVRDDSSITIDDSYLVRQWAYINRISKAADWVARQDNSVHFMEMTSFG
FT                   CGPDAFLQDEVRGILQRHGKALTLLKIDDVSNIGSLKLRVRSVVESIRYNRDAKFAATP
FT                   FEQPPRFEKSMKDYTILAPFFTPFISPLIPSVLKNLGYHVETLPESTVQSADLGLKFAN
FT                   NEVCYPATLVVGDFIRALQSGKYDPSHTAVAITQTGGQCRASNYFGLIKHALISAGFKN
FT                   TPVLSLATSKNIQNDQPGFELNWLKIARITVSTVLFSDCLAKFFNASVVRETVKGKAAE
FT                   LKEKYLELAKKEIEANSPGGLQKLLKEAAAEFNALAKPDVHLPQVGIVGEIYLKFNAFA
FT                   HKNITGWLMDHSIEVMPPLLTPFFMQAFVNRITNRKFGLERHHMPNLIVDALYMWVSKQ
FT                   VKKFNEIGEEFQYFTPIEDIFDLANDGKSIINMAAQFGEGWLLPAEVVNFAKHGIENVI
FT                   SLQPFGCIANHIISKGIEKKIKSLYPHMNLLSLDFDSGVSDVNVTNRLLLFVENIRTSA
FT                   APVPAAKPKKKENFFDENLAKREIMI"
FT                   /protein_id="YP_003397891.1"
FT   misc_feature    complement(198042..>198809)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="Acfer_0168"
FT   misc_feature    complement(197073..198344)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="Acfer_0168"
FT   misc_feature    complement(195831..196874)
FT                   /note="CoA enzyme activase uncharacterized domain
FT                   (DUF2229); Region: DUF2229; cl12083"
FT                   /db_xref="CDD:159743"
FT                   /locus_tag="Acfer_0168"
FT   misc_feature    complement(194619..195767)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3581"
FT                   /db_xref="CDD:33381"
FT                   /locus_tag="Acfer_0168"
FT   gene            199232..200845
FT                   /db_xref="GeneID:8736607"
FT                   /locus_tag="Acfer_0169"
FT   CDS_pept        199232..200845
FT                   /locus_tag="Acfer_0169"
FT                   /gene_family="HOG000216710" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: polysaccharide biosynthesis protein; multi
FT                   antimicrobial extrusion protein MatE; KEGG: amt:Amet_0163
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="GI:284047553"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="GeneID:8736607"
FT                   /translation="MEQQGQTPGNSKTKKFLKGTLILTISSIVVKVIGALNWVILSRVM
FT                   GGEGIGLYQMGFPIYLMAITVSSAGIPVAISIITAEKVAKEDYTGAQRVFRVSLRMLFC
FT                   TGLFFSLCLLGMAHWLVTSGIIPDPRAYYSIIALAPAVFFVTFLSSFRGYFQGWQIMTP
FT                   TACSEITEQLVRVVTMIAFSYLLMPYGLTYAAAGASMGAGAGALCGLLLLQVFYFRLKH
FT                   KFFPKGEQKVPEREQEPAGKIIKRLIALALPVSMSSLMLPIVSNLDMMIVPRRLMVGGW
FT                   SMSEATTLFGYLTGMAVPLINMSTILTAALSISLVPAISESRVLEDTEGIREKVATAFS
FT                   VAAVITIPCSIGLHVLGGRVAALIYNAPKAGPSIETMSWAIFLLGLHQVSTGILQGLGK
FT                   TKIPVFNMILAAASKVLLNWNLTPTLGIVGSSWATVADIGIAAVLNLFFIKKYTGFSLE
FT                   LKQLGKTALAAVAMGAAVKGFLALVPGWGAWSILGGMAVAVPVYGILLLGLKTMPEEEL
FT                   YQIPFLGRRMVVLGKKLKLL"
FT                   /protein_id="YP_003397892.1"
FT   misc_feature    199277..200617
FT                   /note="stage V sporulation protein B; Region: spore_V_B;
FT                   TIGR02900"
FT                   /db_xref="CDD:163065"
FT                   /locus_tag="Acfer_0169"
FT   misc_feature    199277..200200
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt; cl10513"
FT                   /db_xref="CDD:175223"
FT                   /locus_tag="Acfer_0169"
FT   gene            complement(200889..201314)
FT                   /db_xref="GeneID:8736608"
FT                   /locus_tag="Acfer_0170"
FT   CDS_pept        complement(200889..201314)
FT                   /locus_tag="Acfer_0170"
FT                   /gene_family="HOG000267216" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /codon_start="1"
FT                   /product="Endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: pde:Pden_3421
FT                   endoribonuclease L-PSP"
FT                   /db_xref="GI:284047554"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="GeneID:8736608"
FT                   /translation="MKDPIPQGKYVPAARSGRLIATAGMTPRKEGVLIMQGKVQATVSL
FT                   EIYREAVVQAAANALTAARNQLRPGEVLARILRMDVYVNGAADFTAHPRLADFASEYLL
FT                   EELRDAGRCARCALGMAGLPGNAPVEISLLAVVKEKE"
FT                   /protein_id="YP_003397893.1"
FT   misc_feature    complement(200910..201305)
FT                   /note="This group of proteins belong to a large family of
FT                   YjgF/YER057c/UK114-like proteins present in bacteria,
FT                   archaea, and eukaryotes with no definitive function.  The
FT                   conserved domain is similar in structure to chorismate
FT                   mutase but there is no sequence...; Region:
FT                   YjgF_YER057c_UK114_like_1; cd02199"
FT                   /db_xref="CDD:100006"
FT                   /locus_tag="Acfer_0170"
FT   misc_feature    complement(order(200913..200915,200919..200921,
FT                   200925..200927,200955..200981,201003..201005,
FT                   201015..201017,201024..201026,201069..201071,
FT                   201075..201077,201081..201086,201090..201092,
FT                   201243..201248,201252..201254,201258..201260,
FT                   201267..201269,201273..201275,201282..201287))
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100006"
FT                   /locus_tag="Acfer_0170"
FT   misc_feature    complement(order(200925..200927,200970..200972,
FT                   201024..201026,201036..201038,201285..201287))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100006"
FT                   /locus_tag="Acfer_0170"
FT   gene            complement(201330..202616)
FT                   /db_xref="GeneID:8736609"
FT                   /locus_tag="Acfer_0171"
FT   CDS_pept        complement(201330..202616)
FT                   /locus_tag="Acfer_0171"
FT                   /gene_family="HOG000266572" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /codon_start="1"
FT                   /product="aminotransferase class V"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class V; KEGG: aoe:Clos_2343
FT                   aminotransferase class V"
FT                   /db_xref="GI:284047555"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736609"
FT                   /translation="MHKNFTFDPELQKEIKSRFYYMDENPLGRKRLFFENSGGSLRLKA
FT                   CVEAKARYEQIPDCPLRYHDVSLKLHEIKDKGIRDLMEVLFGAAPGEGALVTELTPSKV
FT                   TFSITRAIVENVPGTNVVTTAIEHPSAYDAARMYAEKTGKEFRVAKANPENGGVDVDEI
FT                   LKLVNKDTCLLSVMSASNISGKVFPMKEIVEKARQIKPDLFIISDAVQHAPHAALYAHD
FT                   LQLDGLVIAPYKAMGIRGCGYGYVSDRVAALPHDKLLAKPEKEWELGTYPHANFAAMSA
FT                   MVDYICWIGRHYTDIQDRRTQYIVGFQYCHAHENSLLERMLEGTEALPGLRHIPGVELY
FT                   FDGPVDDSRDLVVAMGLKGMDYTALREEYDKRGVLVFERINTSEYSKRIVESLGRTGLL
FT                   RVSPLHCHDFSDIDHFLEITWDIAKAQAR"
FT                   /protein_id="YP_003397894.1"
FT   misc_feature    complement(201366..202592)
FT                   /note="Selenocysteine lyase/Cysteine desulfurase
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: csdA; COG0520"
FT                   /db_xref="CDD:30866"
FT                   /locus_tag="Acfer_0171"
FT   misc_feature    complement(201366..202304)
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Acfer_0171"
FT   misc_feature    complement(order(201915..201917,201924..201926,
FT                   201984..201986,201993..201995,202083..202085,
FT                   202281..202283,202290..202295))
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0171"
FT   misc_feature    complement(201915..201917)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0171"
FT   gene            complement(202644..203858)
FT                   /db_xref="GeneID:8736610"
FT                   /locus_tag="Acfer_0172"
FT   CDS_pept        complement(202644..203858)
FT                   /locus_tag="Acfer_0172"
FT                   /gene_family="HOG000145086" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /codon_start="1"
FT                   /product="aminotransferase class I and II"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   fnu:FN0605 aspartate aminotransferase"
FT                   /db_xref="GI:284047556"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736610"
FT                   /translation="MDLMTAKFQRLGIDNAPGQEDRQSHTELELRGEPLPGPAVNFSHG
FT                   DVDAHQPIPGSLETFIEGYKKGSCVAYTEYRGGDDIRKEVAAKLAAFTGAPIDPEKELI
FT                   LTPGTQGALFLALGCLVGRGDKVAIVEPDYFDNRKLVEFFEGELVPVKLDYLSQDKNAG
FT                   VNLAALEESFKQGVKLFLYSNPNNPTGVIFSEEETREIARLAKKYNVILLVDQLYSRQI
FT                   FDNHPYTHLRALPERPENMLTIMGPSKTESLSGFRLGTAFGTSWIIDRMEKLQAIVTLR
FT                   APGYSQYVFKRWFSEPEGWLKDRIAAHQAIRDDLIALVRSHEGCSVRKTEGGSYIFPTL
FT                   PPMDVSISDFAKIVRRLTGVIITPGTEFGPQFTHSFRVNFSQDPKNTHSAIDRVLQVME
FT                   RYRSK"
FT                   /protein_id="YP_003397895.1"
FT   misc_feature    complement(202659..203744)
FT                   /note="hypothetical protein; Provisional; Region: PRK08912"
FT                   /db_xref="CDD:169585"
FT                   /locus_tag="Acfer_0172"
FT   misc_feature    complement(202659..203741)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0172"
FT   misc_feature    complement(order(203088..203090,203112..203117,
FT                   203121..203123,203205..203207,203298..203300,
FT                   203457..203459,203529..203537))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0172"
FT   misc_feature    complement(order(202992..202994,203001..203003,
FT                   203088..203096,203226..203228,203427..203429,
FT                   203526..203528))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0172"
FT   misc_feature    complement(203112..203114)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0172"
FT   gene            204220..205119
FT                   /db_xref="GeneID:8736611"
FT                   /locus_tag="Acfer_0173"
FT   CDS_pept        204220..205119
FT                   /locus_tag="Acfer_0173"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: aoe:Clos_2342 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:284047557"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:8736611"
FT                   /translation="MDTESLYLFRDLCRTRNMTQTAKNFFLTQSTLSKRLARLEEELGY
FT                   PLLLRSKGRKEAELTGKGERFLGVVVHMLELYEEGLSFREEQERYLLRLGCMRSAQEYF
FT                   LAGFLQDYLLGHPRCSLTLEDHHSVEIRDLLQEGLLDVGIVQIPLASRGLVSELLYEEP
FT                   FLVVMKEPGHFQGKKIISMEDLDGKQEIFQIFTEEFRSWHDQYWRALDSKIRVNSTPTA
FT                   EKYFQGPEDWMLVPRSVAAAMKKQGFSIFPLAERTPFHRLYLASRQGEDRLWVKEMTAA
FT                   LQQHFQDLKKGQMDRRSF"
FT                   /protein_id="YP_003397896.1"
FT   misc_feature    204220..205086
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0173"
FT   misc_feature    204229..204411
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0173"
FT   misc_feature    204493..205029
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0173"
FT   misc_feature    order(204535..204540,204544..204549,204556..204558,
FT                   204568..204570,204574..204594,204856..204873,
FT                   204889..204894,204898..204900)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0173"
FT   gene            complement(205317..206273)
FT                   /db_xref="GeneID:8736612"
FT                   /locus_tag="Acfer_0174"
FT   CDS_pept        complement(205317..206273)
FT                   /locus_tag="Acfer_0174"
FT                   /gene_family="HOG000283896" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /codon_start="1"
FT                   /product="Peptidase M23"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase M23; KEGG: tte:TTE0841 membrane
FT                   proteins related to metalloendopeptidase"
FT                   /db_xref="GI:284047558"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="GeneID:8736612"
FT                   /translation="MEKKELTEKFKGLKGLLPSGHLVVTGFSFQWKDADGQIQEFHAGP
FT                   KLLMGFCGAFLASLMGLAVCAGLLFKAWDEQTELANYRADYGVYTERLAKLMDDNEKLQ
FT                   RELAQVVQVENAVREKLSKDGVKIGEQAVDKKSKELDKGGQGGSTTADQLTVLEVQDEI
FT                   NWKKLAYKKENLTNMLLALSNTGDGTYGWPVSGGEISSFFGLRADPFGGGSDYHPGIDI
FT                   AVDYGTPIKASSTGTVEEAQWNGGYGRFVSIDHGNGITTCYGHMSAIAVQPGQTVRRGD
FT                   VIGYAGSSGYSTGPHVHFEVRQNGSPVNPLNFARPMG"
FT                   /protein_id="YP_003397897.1"
FT   misc_feature    complement(205320..206039)
FT                   /note="Membrane proteins related to metalloendopeptidases
FT                   [Cell envelope biogenesis, outer membrane]; Region: NlpD;
FT                   COG0739"
FT                   /db_xref="CDD:31082"
FT                   /locus_tag="Acfer_0174"
FT   misc_feature    complement(205344..205628)
FT                   /note="Peptidase family M23; Region: Peptidase_M23;
FT                   pfam01551"
FT                   /db_xref="CDD:144954"
FT                   /locus_tag="Acfer_0174"
FT   gene            complement(206599..207138)
FT                   /db_xref="GeneID:8736613"
FT                   /locus_tag="Acfer_0175"
FT   CDS_pept        complement(206599..207138)
FT                   /locus_tag="Acfer_0175"
FT                   /gene_family="HOG000011570" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: lpj:JDM1_2932 regulator of phenolic acid metabolism
FT                   PadR"
FT                   /db_xref="GI:284047559"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736613"
FT                   /translation="MTKEDTLQYILLGLLAKRDLTGYDMKKLFGQEVRDFWYARHSQVY
FT                   PELRKLEESGLITSYTSTVGTKLQKKYYRLAATGRQKLRDWLDQPLGDMMPTRDEFTMK
FT                   LYLIRSQKDPQLRQLLQEDIRRHKERLAHLQLRWRLLFPTQEAREKEYGHALILQEAIQ
FT                   RETQKLAWEKKQLAEI"
FT                   /protein_id="YP_003397898.1"
FT   misc_feature    complement(206881..207120)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0175"
FT   misc_feature    complement(206602..206853)
FT                   /note="Virulence activator alpha C-term; Region:
FT                   Vir_act_alpha_C; pfam10400"
FT                   /db_xref="CDD:150982"
FT                   /locus_tag="Acfer_0175"
FT   gene            207334..208317
FT                   /db_xref="GeneID:8736614"
FT                   /locus_tag="Acfer_0176"
FT   CDS_pept        207334..208317
FT                   /locus_tag="Acfer_0176"
FT                   /gene_family="HOG000063453" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /codon_start="1"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: dze:Dd1591_3247 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="GI:284047560"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="GeneID:8736614"
FT                   /translation="MKKCGKVSRLVLSGLFLLGMTGFSGAEAAEQYASKTLEVAPVKTE
FT                   VKQISGVVYEQVPSRGYPNVPMAMDLLQPQKKEKMPAIVYVTGGGFINANRDNGVQLRN
FT                   YLAEKGYVVASITYRVAPTARFPEPLEDVKASIRYLRAHADQWHIDKDRIGIVGGSAGG
FT                   YLSAFAGTTSGTRTFDKGENLQESSQVNCAVDLYGLSDLSRVGMDYSPENQKRHQSAGA
FT                   TEALWVNGSPVFGGKDGGVLADPKATEAANPIAYIGKNSAPMLLMHGTADKVVSPGQTD
FT                   LLYRALKAKGVPAERYEIPGAAHGGVYWVQDKVLQVIGDFFDRYLK"
FT                   /protein_id="YP_003397899.1"
FT   misc_feature    207334..208248
FT                   /note="Esterase/lipase [Lipid metabolism]; Region: Aes;
FT                   COG0657"
FT                   /db_xref="CDD:31002"
FT                   /locus_tag="Acfer_0176"
FT   misc_feature    207646..208314
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Acfer_0176"
FT   gene            208331..209122
FT                   /db_xref="GeneID:8736615"
FT                   /locus_tag="Acfer_0177"
FT   CDS_pept        208331..209122
FT                   /locus_tag="Acfer_0177"
FT                   /gene_family="HOG000236850" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /codon_start="1"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /transl_table="11"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: mjl:Mjls_0759 extradiol
FT                   ring-cleavage dioxygenase III subunit B"
FT                   /db_xref="GI:284047561"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="GeneID:8736615"
FT                   /translation="MEEQKTMPVIFSGHGSPMIALEHNEITEGMDRIGRAVESQFGRPR
FT                   AILMVSAHWYTHGTFVQSAPEPRQVYDMYGFPKELYEVKYPAKGDGELTRKVQSLLGSA
FT                   VAVNDDWGIDHGAWTVLVHMFPKADIPVVQLSVDGDISYTEEFELGRKLAALREDGYLI
FT                   LGSGNVVHNLREVEWENAGGSDATLRFNDYITEAVLQEDTEKVIGFASHPDASYAVPTP
FT                   DHYLPLLVCLGAAGADRAQVFNKICNLGSMAMTGYAWGMKG"
FT                   /protein_id="YP_003397900.1"
FT   misc_feature    208352..209110
FT                   /note="Catalytic LigB subunit of aromatic ring-opening
FT                   dioxygenase; Region: LigB; pfam02900"
FT                   /db_xref="CDD:111754"
FT                   /locus_tag="Acfer_0177"
FT   misc_feature    208352..209107
FT                   /note="The Class III extradiol dioxygenase, 4,5-DOPA
FT                   Dioxygenase, catalyzes the incorporation of both atoms of
FT                   molecular oxygen into 4,5-dihydroxy-phenylalanine; Region:
FT                   45_DOPA_Dioxygenase; cd07363"
FT                   /db_xref="CDD:153375"
FT                   /locus_tag="Acfer_0177"
FT   misc_feature    order(208370..208378,208487..208489,208673..208675,
FT                   208841..208843,209000..209002,209081..209086)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:153375"
FT                   /locus_tag="Acfer_0177"
FT   misc_feature    order(208370..208372,208487..208489,209000..209002)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:153375"
FT                   /locus_tag="Acfer_0177"
FT   gene            209239..210633
FT                   /db_xref="GeneID:8736616"
FT                   /locus_tag="Acfer_0178"
FT   CDS_pept        209239..210633
FT                   /locus_tag="Acfer_0178"
FT                   /gene_family="HOG000271513" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: sak:SAK_1211
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="GI:284047562"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="GeneID:8736616"
FT                   /translation="MAYQTIYPYTNEVLRSYESLSDAGVEEALERAYGQYQAWQKDNDV
FT                   ENRKTVLRQVAALLRRDLDRYAETMTKDMGKLFVEARGEVELCAAIAEYYADQADGFLA
FT                   REPVETPAGKAYILKQARGVIMAVEPWNFPFYQVMRVFAPNFIIGNPLLLKHASNCPGS
FT                   ALAFEALVREAGAPEGAFQNLFASYDQVSRIIEDSRVAGACLTGSERGGSSVAEHAGKA
FT                   LKPSSLELGGNDAFIVLDDADMDEVKSQLFAARLYNAGQVCVSSKRFIVTEKNYDRFLR
FT                   DLTEVFASAQWGDPMDPATTLAPLSSATAKRDVLAAIEQAVQAGARVVYGNQPIESPGY
FT                   FVMPTILTDVTKDNPLYNKEVFGPVGVVYKVRDEEDAIALANDSSYGLGNTVFSSDMEH
FT                   AGRVAARIETGMSFINHGWTSLPELPFGGVKNSGYGHELSRSGFDTFVNQHLVFIPQTV
FT                   WERHGK"
FT                   /protein_id="YP_003397901.1"
FT   misc_feature    209311..210600
FT                   /note="Mycobacterium tuberculosis succinate-semialdehyde
FT                   dehydrogenase 1-like; Region: ALDH_SSADH1_GabD1; cd07100"
FT                   /db_xref="CDD:143418"
FT                   /locus_tag="Acfer_0178"
FT   misc_feature    order(209620..209634,209656..209658,209701..209703,
FT                   209707..209712,209851..209862,209869..209871,
FT                   209878..209883,209923..209931,210025..210027,
FT                   210316..210318,210322..210324,210400..210402,
FT                   210514..210516)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143418"
FT                   /locus_tag="Acfer_0178"
FT   misc_feature    order(209632..209634,209923..209925,210016..210018,
FT                   210025..210027)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143418"
FT                   /locus_tag="Acfer_0178"
FT   gene            complement(210677..211918)
FT                   /db_xref="GeneID:8736617"
FT                   /locus_tag="Acfer_0179"
FT   CDS_pept        complement(210677..211918)
FT                   /locus_tag="Acfer_0179"
FT                   /gene_family="HOG000023469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /codon_start="1"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   cpr:CPR_1965 aminopeptidase"
FT                   /db_xref="GI:284047563"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="GeneID:8736617"
FT                   /translation="MDIQETLTRQLPLYARVLLQKGICLQKDQILVINAPVEASRFATL
FT                   LTEEAYKAGAAQVVFNWYCNGTTRLRYEYETQDKFESVPHWRSEFNLDYYRKGAAFLSL
FT                   ISADPYAMKGIDRKKIMAWQKAFHQAVKEYSDGMMASKTNWLVAAVPSTVWARLLYPEL
FT                   PEQEGMDRLWIQLLDAARCLGEDPLADWDKHLAELKQRREWLTAQQFTALEYENGLGTH
FT                   LTVGLPDRHIWQGGAESTARGFLFNANIPTEEVYSAPQADRVDGVVCSTRPLVYSGNLI
FT                   ENFRLTFKNGKVVEATAKKGEEVLKDLLKMDEGACRLGEVALIPYHSPISLMDTVFYET
FT                   LLDENASCHLALGDAYPTCVEKGAEMDEEELKKAGLNDSMIHVDFMVGSPDLTITGIRK
FT                   DGTKVSVFVNGDWA"
FT                   /protein_id="YP_003397902.1"
FT   misc_feature    complement(210683..211879)
FT                   /note="Thermophilic metalloprotease (M29); Region:
FT                   Peptidase_M29; pfam02073"
FT                   /db_xref="CDD:145308"
FT                   /locus_tag="Acfer_0179"
FT   gene            212240..212551
FT                   /db_xref="GeneID:8736618"
FT                   /locus_tag="Acfer_0180"
FT   CDS_pept        212240..212551
FT                   /locus_tag="Acfer_0180"
FT                   /gene_family="HOG000159797" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cthe_2261"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_2261 hypothetical protein"
FT                   /db_xref="GI:284047564"
FT                   /db_xref="GeneID:8736618"
FT                   /translation="MSMLEDIKNAEQKADDLKKQATLEARNTVRDAQAEAHKEAEALIA
FT                   EARKQAAAAIAQAEAQAKQEADALVAENRKRDEAQAAEARKNLDAAVQYIMKKVVIEC"
FT                   /protein_id="YP_003397903.1"
FT   gene            212545..214401
FT                   /db_xref="GeneID:8736619"
FT                   /locus_tag="Acfer_0181"
FT   CDS_pept        212545..214401
FT                   /locus_tag="Acfer_0181"
FT                   /gene_family="HOG000056509" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01496"
FT                   /codon_start="1"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: V-type ATPase 116 kDa subunit; KEGG:
FT                   tex:Teth514_2369 H(+)-transporting two-sector ATPase"
FT                   /db_xref="GI:284047565"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="GeneID:8736619"
FT                   /translation="MLVPMQKLTLYALKADRDALLLALQKDGSVMLEPEAGSKALPGSE
FT                   KVSAQLDKTGQVLQFLVQNGAKNPLFPQKETISYGNFLEETQEGRKLTEKLDTTASKIA
FT                   SLESEAAALRTQAESLDPWLELDIPLEQLSFTETTRCHVGFLPEKELPEFQKAISGLLA
FT                   DVSLYGVTQDGQAMVVLAYEEADSEVKHLLKEHDFSEAVLPKHSGLAADVRKELLQEAE
FT                   EKEARISRLKEETRESIPRKQQVELYYDQLSAAHDRLQNGGVETVSAFKVQGWVRKDRT
FT                   QRVEKVVQSVTDAYQLTFADPAEGEIPPTVLENGKLVEPYESVVELYSLPKAGSIDPDL
FT                   VMAPFHFIFFGMMLSDAGYGLVLTVMLYFALKKFRPTGFARQLAMVIFFGSISTIIWGA
FT                   MFGGWFGLEWQPLLFVPMKEPLKMLALCFGLGAIHLVAGMVVKIYMLLRDGDVMGAVCD
FT                   QISWLIMFLGFFLMALVPGPVGKYLAWLGAGIIVLFGGREKKGIVNRLLGGLLTLYNIS
FT                   GYLSDLLSYSRIFALGLATGVIAMVINTVAQMLWSAGPVGIVAAILVLLAGHYFNIIIN
FT                   VLGAFVHSSRLQYIEFFGKFYEAGGRAFLPLALRTKYTDITK"
FT                   /protein_id="YP_003397904.1"
FT   misc_feature    212617..214386
FT                   /note="V-type ATP synthase subunit I; Validated; Region:
FT                   PRK05771"
FT                   /db_xref="CDD:168236"
FT                   /locus_tag="Acfer_0181"
FT   gene            214416..214892
FT                   /db_xref="GeneID:8736620"
FT                   /locus_tag="Acfer_0182"
FT   CDS_pept        214416..214892
FT                   /locus_tag="Acfer_0182"
FT                   /gene_family="HOG000056521" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /codon_start="1"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: tpd:Teth39_2263 V-type ATP synthase subunit K"
FT                   /db_xref="GI:284047566"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="GeneID:8736620"
FT                   /translation="MITLGTALAFGGAATAAALAGVGSAIGVGIAGQAASGVVSEDPDK
FT                   FGNVLVLQALPGTQGIYGLLIAFIIILNLGVIDGNVKDLTTFQGLAYLFAALPMGIGGL
FT                   LSAIYQGKVAASGIYLTAKRPEETGKGIILTAMVETYAVLSLLISFIMVNGIKL"
FT                   /protein_id="YP_003397905.1"
FT   misc_feature    214683..214880
FT                   /note="ATP synthase subunit C; Region: ATP-synt_C; cl00466"
FT                   /db_xref="CDD:174222"
FT                   /locus_tag="Acfer_0182"
FT   gene            214909..215517
FT                   /db_xref="GeneID:8736621"
FT                   /locus_tag="Acfer_0183"
FT   CDS_pept        214909..215517
FT                   /locus_tag="Acfer_0183"
FT                   /gene_family="HOG000015499" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01991"
FT                   /codon_start="1"
FT                   /product="H+transporting two-sector ATPase E subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: H+transporting two-sector ATPase E subunit;
FT                   KEGG: cth:Cthe_2264 H+-transporting two-sector ATPase, E
FT                   subunit"
FT                   /db_xref="GI:284047567"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="GeneID:8736621"
FT                   /translation="MSGDKIIQKIEEEAKQDAAAIGAAAQEKARKEKEQILAKAREEVR
FT                   EIQAKSQVDAKEAAGRLQLIAELQSRKENLASKRKVLQEAFDQAAGQLEALPQEQWENL
FT                   IGRIILESDLTGRETLVVPAKDRPRYENGFLARLNGELKAQGREGALALSDKEADFADG
FT                   VLIEGDTCDYDGSFATLLEDVRTGEEYRVAELLFGAEVK"
FT                   /protein_id="YP_003397906.1"
FT   gene            215519..216514
FT                   /db_xref="GeneID:8736622"
FT                   /locus_tag="Acfer_0184"
FT   CDS_pept        215519..216514
FT                   /locus_tag="Acfer_0184"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01992"
FT                   /codon_start="1"
FT                   /product="H+transporting two-sector ATPase C (AC39)
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: H+transporting two-sector ATPase C (AC39)
FT                   subunit; KEGG: cbl:CLK_2013 V-type ATP synthase subunit C"
FT                   /db_xref="GI:284047568"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="GeneID:8736622"
FT                   /translation="MAQPSYEYALGRISVLSTHLLTAAQLRRIAEADSTKAAMKLLLET
FT                   GYGENTATEQELAQGEIDLIIRAQMQLTRKRIQELTPDPELTGLFLLPVDTHNLKCLLK
FT                   ARLLGTQADAILREGGNFDLNLLKDMVQTKYYEDLPPIYCQTLNEIEGELAREADPFRL
FT                   SALLDGAMFRQAKAVLDRKKEDGFIRKYFSLWADYLNTISLIRAQNLHWELSQLRLVLV
FT                   DCGEIPRTVFEESLDVPPEQLGARLNQGSHGAELVQAINEFAQTNELGVIARRMEEGLS
FT                   LILRRARWDTHSLGPIVGYLEARETEAEALRMIFGAIQGGFEPQLPSVYA"
FT                   /protein_id="YP_003397907.1"
FT   misc_feature    215519..216490
FT                   /note="Archaeal/vacuolar-type H+-ATPase subunit C [Energy
FT                   production and conversion]; Region: NtpC; COG1527"
FT                   /db_xref="CDD:31716"
FT                   /locus_tag="Acfer_0184"
FT   misc_feature    215534..216418
FT                   /note="ATP synthase (C/AC39) subunit; Region:
FT                   vATP-synt_AC39; cl00660"
FT                   /db_xref="CDD:174334"
FT                   /locus_tag="Acfer_0184"
FT   gene            216541..216867
FT                   /db_xref="GeneID:8736623"
FT                   /locus_tag="Acfer_0185"
FT   CDS_pept        216541..216867
FT                   /locus_tag="Acfer_0185"
FT                   /gene_family="HOG000056544" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01990"
FT                   /codon_start="1"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit; KEGG: cdf:CD2956A V-type ATP synthase subunit F"
FT                   /db_xref="GI:284047569"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="GeneID:8736623"
FT                   /translation="MDKKKIAVIGDPSSVMIFKAVGFDVFYEEEQEQIERRIHRLADGG
FT                   YAVIYITETAAQKAQAVIAEYATATFPAIIPIPAGNKSLGLGMKRVRENVEKAVGADIL
FT                   FKEG"
FT                   /protein_id="YP_003397908.1"
FT   misc_feature    216547..216852
FT                   /note="ATP synthase (F/14-kDa) subunit; Region: ATP-synt_F;
FT                   cl00632"
FT                   /db_xref="CDD:174320"
FT                   /locus_tag="Acfer_0185"
FT   gene            216877..218649
FT                   /db_xref="GeneID:8736624"
FT                   /locus_tag="Acfer_0186"
FT   CDS_pept        216877..218649
FT                   /locus_tag="Acfer_0186"
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /codon_start="1"
FT                   /EC_number="3.6.3.14"
FT                   /transl_table="11"
FT                   /note="PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: tpd:Teth39_2259
FT                   ATP synthase, A subunit"
FT                   /db_xref="GI:284047570"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="GeneID:8736624"
FT                   /translation="MSGKIVKVSGPLIVAEGMKDVQLHDMVRVSDKRLIGEVIELRDDK
FT                   ASIQVYEETAGLGPGEPVESTGSPMSVELAPGLIESIFDGIQRPLEKIYELAGDRISRG
FT                   VEVPKLNREKKWQFVPVAKPGDQVSGGDVIGTVQETPAVLHKIMVPPGKSGTVEWVYEG
FT                   EATILDPVYKLKDSKGNVQEYPMLQQWPVRVARPYKTKLPPEEPMVTGQRVIDTLFPIA
FT                   KGGVAAVPGPFGSGKTVIQHQLAKWADADIIVYVGCGERGNEMTDVLNEFPALNDPRTG
FT                   LPLMKRTVLIANTSDMPVAAREASIYTGITIAEYYRDMGYKVAIMADSTSRWAEALREM
FT                   SSRLEEMPGEEGYPAYLSSRLAEYYERAGEVECLGQEDRVGAVSAIGAVSPPGGDISEP
FT                   VSQATLRIVKVFWCLSSALAYARHFPAIDWLQSYSLYSDRLRAYYDAKVAPDWSKLVGT
FT                   AMEILQEESNLNEIVRLVGIDALGFKDRITMECARSIREDFLHQNSFHEVDTYTSLEKQ
FT                   YDMLKLIITWYEKALDAMTKHVKLDKLIDMPIREQIGRAKYIPEKERKEKFGQLNRDLE
FT                   QAFAELTEEGEENA"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /protein_id="YP_003397909.1"
FT   misc_feature    216877..218628
FT                   /note="V-type ATP synthase subunit A; Provisional; Region:
FT                   PRK04192"
FT                   /db_xref="CDD:167742"
FT                   /locus_tag="Acfer_0186"
FT   misc_feature    216889..217077
FT                   /note="ATP synthase alpha/beta family, beta-barrel domain;
FT                   Region: ATP-synt_ab_N; pfam02874"
FT                   /db_xref="CDD:145823"
FT                   /locus_tag="Acfer_0186"
FT   misc_feature    217081..218184
FT                   /note="V/A-type ATP synthase catalytic subunit A. These
FT                   ATPases couple ATP hydrolysis to the build up of a H+
FT                   gradient, but V-type ATPases do not catalyze the reverse
FT                   reaction.  The Vacuolar (V-type) ATPase is found in the
FT                   membranes of vacuoles, the golgi...; Region: V_A-ATPase_A;
FT                   cd01134"
FT                   /db_xref="CDD:30000"
FT                   /locus_tag="Acfer_0186"
FT   misc_feature    217567..217590
FT                   /note="Walker A motif/ATP binding site; other site"
FT                   /db_xref="CDD:30000"
FT                   /locus_tag="Acfer_0186"
FT   misc_feature    217846..217860
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:30000"
FT                   /locus_tag="Acfer_0186"
FT   misc_feature    218236..218628
FT                   /note="ATP synthase alpha/beta chain, C terminal domain;
FT                   Region: ATP-synt_ab_C; pfam00306"
FT                   /db_xref="CDD:144044"
FT                   /locus_tag="Acfer_0186"
FT   gene            218642..220033
FT                   /db_xref="GeneID:8736625"
FT                   /locus_tag="Acfer_0187"
FT   CDS_pept        218642..220033
FT                   /locus_tag="Acfer_0187"
FT                   /gene_family="HOG000165320" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /codon_start="1"
FT                   /EC_number="3.6.3.14"
FT                   /transl_table="11"
FT                   /note="PFAM: H+transporting two-sector ATPase alpha/beta
FT                   subunit central region; H+transporting two-sector ATPase
FT                   alpha/beta subunit domain protein; KEGG: cth:Cthe_2268
FT                   V-type ATP synthase subunit B"
FT                   /db_xref="GI:284047571"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="GeneID:8736625"
FT                   /translation="MRKDYKTIREVVGPLMLVDQVKGATYDELVEIHQANGELRKGKVL
FT                   TVDGDKALVQLFEDSQGLQPATAKARFLGHGIQLGVSPAMLGRVFDGMGSPIDGGPAII
FT                   PEEYKDINGEPMNPAAREYPSEFIQTGVSAIDGLNTLVRGQKLPVFSGSGLPHAQLAAQ
FT                   IARQARVRGTDEKFAVVFAAVGITFEEANFFMQDFNRTGALSRAVMFINLANDPAVERI
FT                   ATPRMAITAAEYLAFELDMHVLVIITDITNYADALREVSAARKEVPGRRGYPGYLYTDL
FT                   ATMYERAGRIRGKKGSITMIPILSMPEDDKTHPIPDLTGYITEGQIILSRELYRKGLTP
FT                   PIDVLPSLSRLKDKGVGKGKTREDHADTMNQLFAAYSRGKQAKELATILGDSALSKVDK
FT                   LYAQFADAFEKEYVSQGYRTNRSIEETLDLGWKLLGILPRSELKRIRDEYLDKYYKPAD
FT                   GSKGE"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /protein_id="YP_003397910.1"
FT   misc_feature    218645..220024
FT                   /note="V-type ATP synthase subunit B; Provisional; Region:
FT                   PRK04196"
FT                   /db_xref="CDD:167745"
FT                   /locus_tag="Acfer_0187"
FT   misc_feature    218663..218863
FT                   /note="ATP synthase alpha/beta family, beta-barrel domain;
FT                   Region: ATP-synt_ab_N; pfam02874"
FT                   /db_xref="CDD:145823"
FT                   /locus_tag="Acfer_0187"
FT   misc_feature    218870..219694
FT                   /note="V/A-type ATP synthase (non-catalytic) subunit B.
FT                   These ATPases couple ATP hydrolysis to the build up of a H+
FT                   gradient, but V-type ATPases do not catalyze the reverse
FT                   reaction. The Vacuolar (V-type) ATPase is found in the
FT                   membranes of vacuoles, the...; Region: V_A-ATPase_B;
FT                   cd01135"
FT                   /db_xref="CDD:30001"
FT                   /locus_tag="Acfer_0187"
FT   misc_feature    219092..219115
FT                   /note="Walker A motif homologous position; other site"
FT                   /db_xref="CDD:30001"
FT                   /locus_tag="Acfer_0187"
FT   misc_feature    219377..219388
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:30001"
FT                   /locus_tag="Acfer_0187"
FT   misc_feature    219740..220006
FT                   /note="ATP synthase alpha/beta chain, C terminal domain;
FT                   Region: ATP-synt_ab_C; pfam00306"
FT                   /db_xref="CDD:144044"
FT                   /locus_tag="Acfer_0187"
FT   gene            220037..220672
FT                   /db_xref="GeneID:8736626"
FT                   /locus_tag="Acfer_0188"
FT   CDS_pept        220037..220672
FT                   /locus_tag="Acfer_0188"
FT                   /gene_family="HOG000230790" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00309"
FT                   /codon_start="1"
FT                   /product="V-type ATPase, D subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: V-type ATPase, D subunit; PFAM:
FT                   H+transporting two-sector ATPase D subunit; KEGG:
FT                   cpy:Cphy_3070 V-type ATP synthase subunit D"
FT                   /db_xref="GI:284047572"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="GeneID:8736626"
FT                   /translation="MATNVNPTRMELTRLKRRLATAVRGHKLLKDKRDEMVRQFMIYIR
FT                   RNHELRLKMEKALQNVSHHFVVARAHMGFLTMNEALLYPARSAEFEVGSKNVMSVDVPT
FT                   LTYTGATADDAAQVPYSFAFTTGELDTAVTELTTCLPDLLELAEVEKTCNMLADEIEKT
FT                   RRRVNALEYVMIPEMQESIKYITMKLSENERASTVRLMKAKEIMAKQA"
FT                   /protein_id="YP_003397911.1"
FT   misc_feature    220037..220648
FT                   /note="ATP synthase subunit D; Region: ATP-synt_D; cl00613"
FT                   /db_xref="CDD:174312"
FT                   /locus_tag="Acfer_0188"
FT   gene            220785..222137
FT                   /db_xref="GeneID:8736627"
FT                   /locus_tag="Acfer_0189"
FT   CDS_pept        220785..222137
FT                   /locus_tag="Acfer_0189"
FT                   /gene_family="HOG000223052" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   bha:BH0578 GntR family transcriptional regulator"
FT                   /db_xref="GI:284047573"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736627"
FT                   /translation="MLTTFNFRAQPGKEPLYRQLADYFRQEIRQQHLVSQDFLPSIRKL
FT                   TRDLKLSRTTAENAYQILIDQGYVENLPNRGYRVAVYQPREASEGQEAGEELRRPEVRW
FT                   NFSNNYIDTSTFDTVLWRRCLNQVLRNPASIAGYGDPQGEPELRRVLARYSYASRGVVC
FT                   RPEQILVGAGLQTLLLILLPLLPLDQKVAGLEAPGFPQAEQIFHLMGWKTRLFDPADPK
FT                   GDWPGLLMISPANPYKGRALTEKERNNLIVATQLERVYLLEDDYNGEFRYLHRPTPALH
FT                   SFGNREQIIYLGSFSRTMLPSLRISYLVLPEKLLPAYEAIADRYNQTSSTVEQLALAAY
FT                   IEEGHLTRHIRKLRSLYRTKSRRLKEELTSRFGSKVRLLSYGSGLHLHIALDLPGTAEE
FT                   LARKALAQGVRVIPVRGTEPGRSPEFLLSFAGIPEEKIREGVEAFREALEK"
FT                   /protein_id="YP_003397912.1"
FT   misc_feature    220818..222128
FT                   /note="Transcriptional regulators containing a DNA-binding
FT                   HTH domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs [Transcription / Amino acid
FT                   transport and metabolism]; Region: ARO8; COG1167"
FT                   /db_xref="CDD:31361"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    220827..221024
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    order(220827..220829,220833..220835,220902..220904,
FT                   220908..220913,220935..220949,220953..220958,
FT                   220965..220967,220995..221000,221004..221015)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    221097..222122
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    order(221301..221309,221379..221381,221487..221489,
FT                   221583..221585,221664..221666,221670..221675,
FT                   221694..221696)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    order(221310..221312,221409..221411,221562..221564,
FT                   221688..221696,221781..221783,221790..221792)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0189"
FT   misc_feature    221673..221675
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0189"
FT   gene            222230..222787
FT                   /db_xref="GeneID:8736628"
FT                   /locus_tag="Acfer_0190"
FT   CDS_pept        222230..222787
FT                   /locus_tag="Acfer_0190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047574"
FT                   /db_xref="GeneID:8736628"
FT                   /translation="MKNTWEIALLTVMLGLGGPAAGEAAQYFAPRYNLSANGQLQPPLT
FT                   VEFQKGVPQKISASLTGTDGGEKVLVLGWQVGDGVGLCTLQKGVDYALYKLDFRPGKQD
FT                   ILVLSYGHRGTGKTHLNEVTVIGEDSLGVIRQLPVNGFVPTAVFNSPLQIRQQEAVLFL
FT                   EQAPHVLVLRADGENGYVAEVE"
FT                   /protein_id="YP_003397913.1"
FT   gene            222803..223378
FT                   /db_xref="GeneID:8736629"
FT                   /locus_tag="Acfer_0191"
FT   CDS_pept        222803..223378
FT                   /locus_tag="Acfer_0191"
FT                   /gene_family="HOG000146732" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /codon_start="1"
FT                   /product="nitroreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: nitroreductase; KEGG: shi:Shel_04910 methylase
FT                   involved in ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="GI:284047575"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="GeneID:8736629"
FT                   /translation="MELASLYDTCRTYRRFEQKPVEPELLRTLADVARKRSCGRNGQCL
FT                   RFTVVESPANVKAMQPLLRWAAALPKEIGTPKEGEQPVAFVVVSRPKDANPTISSIDVG
FT                   IALDAMAITAWQQGVGSAILAAVDRPKIAALLDIPEEREVVTVLALGYPSHQSTLVPGE
FT                   EGKLAYYVDEARDYYVPKLPLEKVAEFK"
FT                   /protein_id="YP_003397914.1"
FT   misc_feature    222833..223276
FT                   /note="Proteins of this family catalyze the reduction of
FT                   flavin or nitrocompounds using NAD(P)H as electron donor in
FT                   a obligatory two-electron transfer,  utilizing FMN or FAD
FT                   as cofactor. They are often found to be homodimers. Enzymes
FT                   of this family are...; Region: Nitro_FMN_reductase;
FT                   cl00514"
FT                   /db_xref="CDD:174256"
FT                   /locus_tag="Acfer_0191"
FT   misc_feature    order(222836..222838,222842..222844,222920..222922,
FT                   223175..223180)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73303"
FT                   /locus_tag="Acfer_0191"
FT   misc_feature    order(223106..223108,223112..223117,223124..223129,
FT                   223136..223138)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:73303"
FT                   /locus_tag="Acfer_0191"
FT   gene            223406..224263
FT                   /db_xref="GeneID:8736630"
FT                   /locus_tag="Acfer_0192"
FT   CDS_pept        223406..224263
FT                   /locus_tag="Acfer_0192"
FT                   /gene_family="HOG000072911" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cbk:CLL_A3210 tRNA uridine 5-
FT                   carboxymethylaminomethyl modification enzyme GidA"
FT                   /db_xref="GI:284047576"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8736630"
FT                   /translation="MLYDIAIVGGGPAGCSAAVTAANRSLGTLLLDTGDFGLALRKSHL
FT                   VKNYLGLPDRSGVELMDAFTAHMKAAGTTVVPHKVLSIMPREKSFFLATPGDVYEARSV
FT                   ILCPGAAHGKPLEGETALLGKGVSYCATCDGFLYRGKTIGVVTNLPSAWEEVEFLAGLA
FT                   AEVKLWADFSLSEEKPANVTVMAGKPRKILGEGKAEALETTAGTEPLDGLFLLRETDPL
FT                   DRLLPGLRLDGPFIRVDGNLATSVPGVFAAGDAAGYPWQINKAAGEGQKALLSAAFWLR
FT                   ENPV"
FT                   /protein_id="YP_003397915.1"
FT   misc_feature    223412..224245
FT                   /note="thioredoxin-disulfide reductase; Region: TRX_reduct;
FT                   TIGR01292"
FT                   /db_xref="CDD:162288"
FT                   /locus_tag="Acfer_0192"
FT   gene            224260..225255
FT                   /db_xref="GeneID:8736631"
FT                   /locus_tag="Acfer_0193"
FT   CDS_pept        224260..225255
FT                   /locus_tag="Acfer_0193"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047577"
FT                   /db_xref="GeneID:8736631"
FT                   /translation="MTGKKTGRFLLALAVMGMLAGGCVRSQPAETGQAAETAAPSETKA
FT                   LAPGEGVQGARVEFVTREHKMERVLFSGGYLRSLPEEKPETILRPAPAGAQGMIFGKRE
FT                   INGLEWAKVATRDGVTGWYTVPAKKGASPRDKREPLQITNEGYRTIFPQVTGGVTSQVQ
FT                   DRINQELGNYLSVYRHITGPVESGLQCRVTYNRRQILSLVFQGDPILYRSYPVTEVNSL
FT                   ASWTRLKHYAYVSPLQGGADPSLLTARITDLHYGLVFDLVTGSRLPLEYFLGQNRQEAI
FT                   RERLADLGEGARFQKDNFYIDTQGHLVALASVPGKGRVEMDLSDLVIREF"
FT                   /protein_id="YP_003397916.1"
FT   gene            225487..225954
FT                   /db_xref="GeneID:8736632"
FT                   /locus_tag="Acfer_0194"
FT   CDS_pept        225487..225954
FT                   /locus_tag="Acfer_0194"
FT                   /gene_family="HOG000065978" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /codon_start="1"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mba:Mbar_A3616 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="GI:284047578"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="GeneID:8736632"
FT                   /translation="MNKKVHFHTNLGDFTAELFEDKAPKTAGNFLELVEKGFYDGVIFH
FT                   RVIDDFMIQGGDPTGTGMGGPGYTIDDEFGPGLAHSGEGILSMANAGPNTGGSQFFITL
FT                   VPTPWLDGHHAIFGKIVEGMDVVHKIGSTPTDFADRPLQDVVMEKVEVVKE"
FT                   /protein_id="YP_003397917.1"
FT   misc_feature    225502..225918
FT                   /note="cyclophilin: cyclophilin-type peptidylprolyl cis-
FT                   trans isomerases. This family contains eukaryotic,
FT                   bacterial and archeal proteins which exhibit a
FT                   peptidylprolyl cis- trans isomerases activity (PPIase,
FT                   Rotamase) and in addition bind the...; Region: cyclophilin;
FT                   cd00317"
FT                   /db_xref="CDD:29390"
FT                   /locus_tag="Acfer_0194"
FT   misc_feature    order(225622..225624,225628..225630,225637..225642,
FT                   225646..225648,225751..225756,225781..225783,
FT                   225787..225789,225811..225816,225826..225828)
FT                   /note="active site"
FT                   /db_xref="CDD:29390"
FT                   /locus_tag="Acfer_0194"
FT   gene            225951..226220
FT                   /db_xref="GeneID:8736633"
FT                   /locus_tag="Acfer_0195"
FT   CDS_pept        225951..226220
FT                   /locus_tag="Acfer_0195"
FT                   /gene_family="HOG000285487" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /codon_start="1"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: ere:EUBREC_0245 putative O-methyltransferase"
FT                   /db_xref="GI:284047579"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="GeneID:8736633"
FT                   /translation="MTAYVYMVRCANGALYTGWTNDLAHRLAMHRSGSGAKYTRAFKAV
FT                   DLAYFEELPDRKTALRREYALKQLAKKQKEELVRQFSQKSLKIP"
FT                   /protein_id="YP_003397918.1"
FT   misc_feature    225960..>226142
FT                   /note="GIY-YIG catalytic domain; Region: GIY-YIG; cl01061"
FT                   /db_xref="CDD:174510"
FT                   /locus_tag="Acfer_0195"
FT   gene            226377..226574
FT                   /db_xref="GeneID:8736634"
FT                   /locus_tag="Acfer_0196"
FT   CDS_pept        226377..226574
FT                   /locus_tag="Acfer_0196"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: pjd:Pjdr2_5748 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="GI:284047580"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="GeneID:8736634"
FT                   /translation="MTGKVKWFNAEKGYGFIEREDGGDVFVHFSAIQGEGFKTLEEGQA
FT                   VEFDVVEGNRGEQAANVVKL"
FT                   /protein_id="YP_003397919.1"
FT   misc_feature    226377..226568
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Acfer_0196"
FT   misc_feature    order(226395..226397,226422..226424,226452..226454,
FT                   226539..226541)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Acfer_0196"
FT   misc_feature    order(226413..226433,226449..226460)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Acfer_0196"
FT   gene            226684..227439
FT                   /db_xref="GeneID:8736635"
FT                   /locus_tag="Acfer_0197"
FT   CDS_pept        226684..227439
FT                   /locus_tag="Acfer_0197"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tna:CTN_0365 oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="GI:284047581"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736635"
FT                   /translation="MIGYGMENKRGVISGGTSGIGLAAARMLVQDGATVWLVGRDPERG
FT                   KKALESLEGLPGKALYLQGNVSTVEGCRKIAACLQQHHQELDFLVNSAGIYQEKPFQDV
FT                   TEEEYQQLMDVNVKGTIFLTQALLDLFAQDGPSIVNIASDAALEGNYGCCLYAASKGAV
FT                   VAFTRSLALDLAPWVRVNCLCPGDVDTPLVEKQLAEGGYSRESMASVYPMGRIGKPEEV
FT                   AHMICAVLSPLNGFMTGAIVSVDGGLTAK"
FT                   /protein_id="YP_003397920.1"
FT   misc_feature    226696..227427
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Acfer_0197"
FT   misc_feature    226696..227427
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Acfer_0197"
FT   gene            227450..228793
FT                   /db_xref="GeneID:8736636"
FT                   /locus_tag="Acfer_0198"
FT   CDS_pept        227450..228793
FT                   /locus_tag="Acfer_0198"
FT                   /gene_family="HOG000270688" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00796"
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: branched-chain amino acid transport system
FT                   II carrier protein; PFAM: branched-chain amino acid
FT                   transport system II carrier protein; KEGG: efa:EF0243
FT                   branched-chain amino acid transport system II carrier
FT                   protein"
FT                   /db_xref="GI:284047582"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="GeneID:8736636"
FT                   /translation="MNHKLTSAEYLFVGSMLFGMLFGAGNLIFPVHMGQLAGSHFWGAN
FT                   LGFISTGVFMPFLALIAFGLSGSGSLEELAGNVHPAFARIFTVLLYLTIGPAFALPRTA
FT                   TVSYQIGIVPFVSGNQTLVLAGFTFLFMAVALLFSLKPSKLIVYIGKFLNPVFLAFLAI
FT                   LVAVALARPMGSIAAGVPQGPYVDHAFLTGFKEGYNTMDVLAMLAFSVVVINTLKELGV
FT                   SDARTISVDLLKVGIIVVFLMALIYTLITWLGTSSLGALAISANGGIALAQIAHAYFGP
FT                   VGGMLLAAIVTFACLKTAIGLITACANTFCDLFPGSLSYKAYCVLFAGISFLIGNVGLT
FT                   QIIVLAVPILMFLYPMAITLILASFASALLGKDRRLYRWPMLLAGVAAFGDALSVLPKG
FT                   LQETGAVQALLGCYHQLPLFSLGMSWLLPTLAALAVAAAAVKLGGVRR"
FT                   /protein_id="YP_003397921.1"
FT   misc_feature    227465..228736
FT                   /note="Branched-chain amino acid transport protein; Region:
FT                   Branch_AA_trans; cl00547"
FT                   /db_xref="CDD:163870"
FT                   /locus_tag="Acfer_0198"
FT   gene            228871..229479
FT                   /db_xref="GeneID:8736637"
FT                   /locus_tag="Acfer_0199"
FT   CDS_pept        228871..229479
FT                   /locus_tag="Acfer_0199"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: azc:AZC_3961 outer membrane protein Omp31
FT                   precursor"
FT                   /db_xref="GI:284047583"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="GeneID:8736637"
FT                   /translation="MKKMMMATAVLSLLPLTVACASPLAKIAPGAAKIDANVTVGNTLK
FT                   WKQDGKTTDFGGDSRYRVGGTVGIADNLGLDYRYAAHEGDHDASAQSHQVSLVYQFNPY
FT                   LYGYGGYVRNRLKQHGYHDNNSGYQVGAMGRLPITDKTTGWAKFGTGNNITQYELGVGY
FT                   AFTDNWEANVSYNDSKYKDFKGDIDAKTHEVNVGVSYKF"
FT                   /protein_id="YP_003397922.1"
FT   misc_feature    <229264..229476
FT                   /note="Surface antigen; Region: Surface_Ag_2; cl01155"
FT                   /db_xref="CDD:174558"
FT                   /locus_tag="Acfer_0199"
FT   gene            229683..231353
FT                   /db_xref="GeneID:8736638"
FT                   /locus_tag="Acfer_0200"
FT   CDS_pept        229683..231353
FT                   /locus_tag="Acfer_0200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /codon_start="1"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /transl_table="11"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; surface antigen (D15); KEGG: gsu:GSU1153
FT                   OMP85 family outer membrane protein"
FT                   /db_xref="GI:284047584"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="GeneID:8736638"
FT                   /translation="MMNHRLTASILLTLLAAPCLWATTAAANAPAHPAGYNDSGVELNR
FT                   TRQYLERQRIARKIQEGRNTQPVEGAEGPEEAQKGAVHFLLKQVELPESQVLSREELQK
FT                   ITGAYEGKDATLDDLYALVGKINALYQEKGYLTCRAFLAPQTIRDGRVKIDLVEGKNGQ
FT                   VEVTGNRSTREKYITDRLHIEPGQISSMHRLNKDLLRFNATNDAQLRIALKAGKEPGTT
FT                   DYVIAVQEPQKQVTGVFFDNAGSKTSGLYRAGLFWQDRDLSGNRDHLFLSTIRSEGMKA
FT                   VAGSYSTPINRTGTRAGLSYSTNSVHITDGPFEALGVRGHSYVATAFLVAPIETTERKK
FT                   SEWGFEYGHQRSQTDFGTSLGLRTHWVDDTVDTGLLYYDQLNYGDSSVLYQKHGYRVGR
FT                   YKDLYDNHRNFGKYEFNGLYQKAYKAGQQWTFRLDGQLSSTQYLPSSEMFYLGGMYSVR
FT                   GYTESLIGGDGGFSASAEYSVPLDKERKVNGYLFLDGGRIWGSSAFGDRSLMGAGVGIK
FT                   ADLTEKISLNVALGLPLQRTINGEEQSRGRIHFTVNGQF"
FT                   /protein_id="YP_003397923.1"
FT   misc_feature    229803..231350
FT                   /note="Hemolysin activation/secretion protein
FT                   [Intracellular trafficking and secretion]; Region: FhaC;
FT                   COG2831"
FT                   /db_xref="CDD:32659"
FT                   /locus_tag="Acfer_0200"
FT   misc_feature    229932..230159
FT                   /note="Surface antigen variable number repeat; Region:
FT                   Surf_Ag_VNR; cl10520"
FT                   /db_xref="CDD:158899"
FT                   /locus_tag="Acfer_0200"
FT   misc_feature    230493..231350
FT                   /note="Surface antigen; Region: Bac_surface_Ag; cl03097"
FT                   /db_xref="CDD:155280"
FT                   /locus_tag="Acfer_0200"
FT   gene            231366..249080
FT                   /db_xref="GeneID:8736639"
FT                   /locus_tag="Acfer_0201"
FT   CDS_pept        231366..249080
FT                   /locus_tag="Acfer_0201"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01731"
FT                   /codon_start="1"
FT                   /product="adhesin HecA family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; KEGG: dol:Dole_0612
FT                   hemolysin-type calcium-binding region"
FT                   /db_xref="GI:284047585"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="GeneID:8736639"
FT                   /translation="MSALYRNKHKKTYKAVKQDDLSRRILAACLSVSFVSQPLTALAGS
FT                   ITAFNGTNYVDKDGVFNIYAQKYNGKNNAVNQFKNFQLDAGKIANLYFHTENDSREAQN
FT                   LLNFVDTRIDINGTLNAIRNKQIGGNLFFLSPGGMAVGKGGVINTGALYVMAPSWTQDF
FT                   TDKDQRSYEILKGNFATGAYGDTELEAIKNGTANIRINASGTISVLGKINAANDVKLYA
FT                   GKVAVGRNLTEDTIDGTAAGGIEKGAAINTGITDFSQLVKLDAEQQKASGLTSLTAVKD
FT                   GSGDVVLSARSDAANSLDQAFNDLVNTTGLLGGTDINVPKTITASVENHGTVTAAGDAA
FT                   LTAKATNGYFKEGEETYSSNASGYAQTVAKVDVQGNVTAQGAVDMKASADNTYVDSGNS
FT                   VTDKLGDTLSYVVPVGANVMLLKNEASVTVGQDATVTGDTVKAEAEANLDGTAGTVAAG
FT                   KKYLKQIPSQIPAAGVSYAKADNKAAVQLDGKVKATGKDTTDSDGNKQEALQVKASATS
FT                   SVTNSANAVVKAGLLGAGSSSIVAAVAVTNSDNNAQIKVNGTAEADKGSVKMDAAATQS
FT                   LNTAAAAQAPDTAVGTAAVDVIVHDGDASIDVQGTVRADQDVTLTATNHTEENTHSANN
FT                   NLGQGKFKAQLMKGVMKAADVQGIVGKVKENPLVKDALSKASKNTGTPASSGSTSSKSL
FT                   TDALGNTLSAGAAITVADETTTARVNFGKNSVTEAKNGSLQASANNTVYDTLLTASGVT
FT                   STFKNTDSDSDTVTIAVGSVFGGMKNSAKVTVEDGTKDKKAQLKAGKDLSLKTSTRMEY
FT                   NRVAEIKKGLDDSVQAVKSAAEEMKDWKEMGQLPELKELYDELVTLEKTLEGISTTFYT
FT                   NYLKHAPDGTNLTAEGTLNEVTNLAATSWNLYNQFLELQNKAMTLYQDIQAQDPLRAVK
FT                   EEVQTKITNLLTSPMDVVSSSMEYLSPNNYANISAAASAKGGQDTAVATAASVTVSDFN
FT                   FDSQVKVGKNAQLTAGDTLELKADEAIKDVTMTGKSKFWLNNAATGKADGVGLGGSFDY
FT                   QDFDNDTLVQVDKGASLTAGDMALASSSDVFHTGVMLSAGKADGSAISGMMALTNSDSS
FT                   NQVLVDKDALLKAVKDEAKKHRGSIAITGYNNTNVNNAILSLSAGSGAAAAGMAAAVNN
FT                   IDVTNRAAVENLTTSDDDDDKGQIEAAALQVNAETTGLMNAVSVAGGVTSSGTEPEKGS
FT                   MSTVGNLFGKVTDPVGTVTSAVGTVSNKVKDAITWVNTGGKSQGGTQTVVPTKSDTAPS
FT                   FSLAGAGSLSLNLVDDTTQAVVDGATVKLNNDGTMSVGARDTAYVGAYSGGAAISLRKG
FT                   KGSKDNTSVAFSGAVGMNSIDNTIEAAVRNSTLTGVKSLDIEALSGGTSVAAGTALALT
FT                   KSGQAGNNFAGGASASVNLIDKDVKALAENNTVTGKSATEKANVDVTAYESDLQVTGGV
FT                   NADVAIGGGNAAGGSLTVANINNNLEAGIHGGTYANIGDTQVQGLLATKQISAAISAGV
FT                   AVGGNGTDNAFTGAMLYNGLHNTVNADISNKASITADSIAVKAHDTTSGSDEAKAYQDQ
FT                   LGNYKEKETMLQDAGIDTDGSSYYKTSDADNGLDTAGETVDFDGNKGSLSVGAAFVVAG
FT                   SKDNAAGAAVNVANLDNTFAAKIDGATLTADKITSQAEADSLAVNVTAGVAAGSKDFGG
FT                   MGSVTWQDQDNRIQSQVTDSTLTTDDLKVHASSNAQAVNVAGSVAYGKTAGVGAALAYN
FT                   GLDNHIGAYLAGGSVTAKTPSTGVSVDVEGKNTGKIYGLGAAVAASQKAAVNGTVVVNH
FT                   GGSDTEAAVGEVRAADGTSTAKATAVTSAKAVKVKAESDDVRVAAAGNVSASGKVALGG
FT                   AVAYNDVGGASASTEKASQKTRAALNKTTLTHVKNGSTSVEAVDGSTLTTAAVGVGGSG
FT                   KVAVQGAAATALVNKAVTAEVQDSKVDKDTDKGAYVTVQADSKSTINSLAVVGAGGGDF
FT                   AGGAGVSVNRINQDTTAALSGSTVRDRHTTVQAAGDSAITSVGLGAAVAGKAALAGNIA
FT                   VNQIGNNVKAAVTGSNLTSSGNIGVLASGKENLTNFAGTVSGAAGNAGLGMGVSYNAIT
FT                   GNTESTVEGSSLEARGKENGTVGDKQKGVVVTASGQHALNSVALTAGLAGSDNVAVGAA
FT                   GTVTVNNIGGTTRAAVTNTDINKNLDNSTADDVAVQAEDVTKSESHVGSLSVGIGADGG
FT                   AGVSAASDTLLLSRNTAAELSGTDTAKKTVNGRNVAVTADQQSTVVTNADGVAGAGGVY
FT                   GAGAAAATAAATRLDGSVTATMKNITSTNKGLEISAKHDHKTTLVSASAALSAAMVSGA
FT                   VGAGVGVVNDDFTTDAELVSSTVAAKKDSSLSDSGSVNVAADSSTSVTTVVAGVSGSVG
FT                   AAASTISVNNVNSQTSAVVDNSKVTADQDFTVDAHNKVTTKFNAASLGAGGAAIATGVG
FT                   VNTIGTSTLAKVNQSTVTARKAAVASREELDVDQNLVGATVGGLGINANVMVTSIGTKL
FT                   ADTYGSSDNKGASFDTAAVLQKANTALDAQKTATADGTTASSKVVRDTLHNTDTGVKST
FT                   DASGVTASSGKRDAKGTQVAVANSAITTADTLDLSADRKTDAKITAASASVSGSLGLSA
FT                   TVAVLDAKKDAGVSISGSTLQANNALTVTADQSGKTTIDAYQANIAGVAAVSAAYAQSS
FT                   SSGETKVEAVDSTLTSDNNDITMRATDASQTASSVYGATAGLVTAGALVSKAENTSDTD
FT                   LAIKGSTLETAQGTADLQADKANIVSARTYGGSFGLVGANGVVALASDEGASKILVAQS
FT                   DSKKNSVFRGQTASLQATTRPAVTAETGSLSVALLGSASASVATASAKGEAGVQIADGT
FT                   TTFDVDKAEITASAESQNGENNSEAKVKGFAAAGRGTAVVNTATANTDIDTEVTLGKAS
FT                   FKKDRGTALNVTSVNATQTAADARGITVGGLFASGTNLAYTGSGTENDANMAAITLTGD
FT                   KTQLKSLSVNASGTTHNLTTADGSGGGMISGDLAGAVDNKTYTGSKVTLKGSWDVNGDV
FT                   AIQSAQTDHMDLNADATKAAVVGASATKADNTANGAADVVLTGSQITSGGTLTAKADSK
FT                   ANLGQNKAYAVEGSGYGGVAVQGAKLNDTVNRTATVDASNASLTSSGSQILAAESGGKI
FT                   NAAGYIKAAGAGAATWVDVDNNLTSQNAIRTDGKTSLRTDTANGNITLSASDDWAVTAK
FT                   GVADTQGGAAGGASSDVKNTLQRTNKVDIQGKVYSLNDVNLYAGKDANGVMDNLDLTVE
FT                   SEAYNKTALSVAVPKFKDTLTQANQVVVGKGAEVSSVRHIHAYADEADKYLREQSVKYT
FT                   WYHSDAKENFTSTSVGKKSDSINDKTDNYVQIDGKVTAGAQNKQNIVIGGSGQIVVLDN
FT                   DELAAVKAVKGQEKAVQRPTIDASSGIDTAKITYARIDYANALMARYYELATLISQYSD
FT                   SKDLTALKGYQDEQTRIYNELDNLGLLSKAIGPDGKEYLVPVSGLTVDTIVLPDIVASG
FT                   GNIVVEAGSLKGAGALKAQGSPEVTVENHTNLYLKVGDVKAVNPGGEIHYNGQSLAKDA
FT                   AAVIKSANQDEAAAVNLTVSTDAATSTGGTVTIKSDYGTAAIKAKIDEVDAKGKKTGKK
FT                   VDAELVPKADIEINGNVEAENGVVNVENKNYSILLQGEGNRTAEVNGKEIHLTAGKSIS
FT                   QGFTQGIVNIGGNPEELYKDKYFNSEVNEFNKAYGYENTSRVHREDRTHDDVLNGSGSR
FT                   IAGDNIYINASDINVNGLIQSGYGKYEVTVADAVTSKVQKLDRSWARMGKQDLSDAVIT
FT                   TGTYYLVQPGGKVLQTDGTYKYQPDVYYNPSTQKLVIPDIDAHGGKIYLSGRISSTGNG
FT                   KIVALDGAYDISVTNPTKTDLQVGKLISNKNDGLISIADSSTNRLTEYTRGSTVVKDLT
FT                   KWDKTTGDWKVLSTSGASSQYNPQKNLRYNWTSGQKVTTRKHYKHDHKAGLWGAVTTLD
FT                   ETELAKYEQEITPQDMGHNTFTNDNGVYIDTSSLTNKDKQYVFVYDNVVLNNDRTQPVV
FT                   TKRWKTGFLGWFHWERTEWDTNTGTAQQYVGSVKADHGINIGFLGNQDGNSAINVTSKA
FT                   GVTLAGKIQSSQSGAGSTITITSQNGAINQNGGLLKGDNIELSAKNGLTNIAIESLGDT
FT                   VKLDAANTGSGNMNITVDGAYGKAGHVDLVQAKNTNGDVSLTVLGNLTQNGTAVAVEGH
FT                   RIDLVSRQGSIGTDTAALKVKTPDTAVDALNPLSSSVNVTAKGNIHLAEDSDMRVGIIK
FT                   STDSDVKLDATGSIIDALPSGDTIDRGNTANLIQGWKDLGLIEGDGQYKQKQAEDVAEY
FT                   KAGVQSEFAQYLKLKSVYEKDEEAAKTDANYQVLKDRYGDYTSADDYLAESDTAKNHLA
FT                   DLQKAGAGWTENELLYAISDAIVNKQQGSTDTELKQANISGQNITLHAKNIGSDKAAED
FT                   VLVKGITTDERLDDLKKVVNANVSDVGYTKNDKGENVFRIYGKVPVGIEAKGELNIQSD
FT                   GNIYVAGRTFGENKDTVLKLGKVTTSTGDIRVLGKAGVTNSLTDGSANLNGKNLILEGG
FT                   SADIGAAGKPIDVDLTGSLSALTDGSMYISSVGNHNLQLSGLYAGKDMVLASKKDIAMS
FT                   PDASAQAYLNAGRLLDLKAEGGIGAKDSGVRILGNGATINAEAKDGNIYLAGKSKAGEQ
FT                   DGLFLLGTVKTSPGHTIAVAAETDLSLGDNEEASMLVSQVQADTVNLSSDREIDLKNGN
FT                   LTAVTLKLKAGGSINQTAAHAITAKTVSVDSASGISLDSGAGLADNPKFNDFQTVTVKN
FT                   GSDATDVIIGSGGSKDLTVSFDTDSKAKNVTVRNYENGAVNNLTVNGPVTAAGGISLVN
FT                   DEADLKTTGTLTVGSGRLHEQAVGALENEDSLTGDDIILNSTKGMINKSLIATHKVELT
FT                   AANDILNQGIVQAGTSVSMKSDTGSINNKGDVEAKGGDVNMDAKTDLHNKGVVKASQDT
FT                   GLKSGGSMANEQAVTAGRNLKMKASTTLTNGGGLTATNGSIELAAQKELLNQGAVQAGT
FT                   SVTMTSVASSITNNGDVEAKDGNVAMDAKTDLQNKGAVTGSQSVELTSDTGSITNQADV
FT                   EAKGGDVTMDAKTDLHNQGVVKASQDAELTSGGSMANEQAVTAGRNLKMKAGTMLTNSG
FT                   GLTATNGSIELTAQKELLNQGAVQAGTTVTMTSAASSITNKGDVEAKGGDVTMDAKTDL
FT                   GNQGAVTASQSVGLKSGGSMANDKAVTAGQDLTMDAGTTLTNGDDLTAENGAVGLTAQK
FT                   ELLNQGAVQAGTSVSMKSDTGSIANQADVEAKGGDVTMDAKTDLGNQGAVTGGQGVELK
FT                   SGGSMANDKDVTAGQDLTMDAGMMLTNGGGLTATNGSIELTAQKGLRQNGNATAGSSIT
FT                   MDNQQDGDLVVTGDVQSGTAATIKNQNGDVTIDGQVEAKTGDATVKTGSGDVLVKGKLE
FT                   AGSDAILQSDNGSVTMGGNVQAGRDLQASTQNGGIVFQGNVESGRDLTASASQGDITFD
FT                   GRVEAGRNLDARTRQEGTITLRQDVTGGGDLRFATNDGSIRFEGNDSQKVEDIHVTSKD
FT                   GEVSMTITGRGNMEDSHRQTGGDRAVVEAGSGNITLKHTGVGDVDLYSLLAGKKAGVEV
FT                   EDGSLYLDTINGDLIAVYVKNPQKTTAIEHMEAGSRLSLSGSTIHVAEISQRPGASSTL
FT                   TLDVDGADQAAPVESLTIGDIKAAHGVRIPHLWVRNGAVKTSQGTLQLDKLFVLDKATF
FT                   SNGTMITDVFGTTPRTDERVHSVYWINTKLGRPQENLSQWLAEAGRGDRWMYLLFDRQG
FT                   HTQFSNGNLVDLDPHNYVYNQRYSETNWTRTMEDRDFSNFWTPCFHPELTYSSRYDLVD
FT                   GSQAVSQPANGEITVEEV"
FT                   /protein_id="YP_003397924.1"
FT   misc_feature    231513..231827
FT                   /note="haemagglutination activity domain; Region:
FT                   Haemagg_act; cl05436"
FT                   /db_xref="CDD:141881"
FT                   /locus_tag="Acfer_0201"
FT   misc_feature    <247623..>248000
FT                   /note="Protein of unknown function (DUF342); Region:
FT                   DUF342; pfam03961"
FT                   /db_xref="CDD:146542"
FT                   /locus_tag="Acfer_0201"
FT   gene            249164..249595
FT                   /db_xref="GeneID:8736640"
FT                   /locus_tag="Acfer_0202"
FT   CDS_pept        249164..249595
FT                   /locus_tag="Acfer_0202"
FT                   /gene_family="HOG000159791" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047586"
FT                   /db_xref="GeneID:8736640"
FT                   /translation="MNPKAQSFQDYLDKEKLKDFTLEEISGEDLKPVVFRSHLALKEAR
FT                   LPVVVVWDLSIYGMVRILVVQKALKKTNETALLKQIDETNRKYKAFKYYLDEEGNLVLD
FT                   ACILCRGQKVDGELVYILFNTLAQHLEEAYGQWMKVVWG"
FT                   /protein_id="YP_003397925.1"
FT   gene            249791..249867
FT                   /note="tRNA-Arg1"
FT                   /db_xref="GeneID:8736641"
FT                   /locus_tag="Acfer_R0009"
FT   tRNA            249791..249867
FT                   /db_xref="GeneID:8736641"
FT                   /locus_tag="Acfer_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(250152..250745)
FT                   /db_xref="GeneID:8736642"
FT                   /locus_tag="Acfer_0203"
FT   CDS_pept        complement(250152..250745)
FT                   /locus_tag="Acfer_0203"
FT                   /gene_family="HOG000002440" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.3.1.1"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.1"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarate lyase; KEGG: cbe:Cbei_3220 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="GI:284047587"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="GeneID:8736642"
FT                   /translation="MSQQKLERSESDSIGTKSVPRDAYYGVQSLRAFENFHITGQTTHP
FT                   TMIRSLAYIKKACALANGRAGALKPASAKAIEAACDRILAGEYLDQFIQDPIQGGAGTS
FT                   LNMNANEVIANIAIEILGGEKGDYSLIHPNDEVNRGQSTNDVIPTAGKLTVLFLLEDLY
FT                   KSLRSLKEAFARKGVEFDSILKMGRTQLQDAVPM"
FT                   /product="Aspartate ammonia-lyase"
FT                   /protein_id="YP_003397926.1"
FT   misc_feature    complement(<250155..250724)
FT                   /note="Lyase class I_like superfamily: contains the lyase
FT                   class I family, histidine ammonia-lyase and phenylalanine
FT                   ammonia-lyase, which catalyze similar beta-elimination
FT                   reactions; Region: Lyase_I_like; cl00013"
FT                   /db_xref="CDD:176574"
FT                   /locus_tag="Acfer_0203"
FT   gene            251010..251378
FT                   /db_xref="GeneID:8736643"
FT                   /locus_tag="Acfer_0204"
FT   CDS_pept        251010..251378
FT                   /locus_tag="Acfer_0204"
FT                   /gene_family="HOG000253615" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03788"
FT                   /codon_start="1"
FT                   /product="LrgA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LrgA family protein; KEGG: ctc:CTC01825
FT                   putative murein hydrolase exporter"
FT                   /db_xref="GI:284047588"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="GeneID:8736643"
FT                   /translation="MNIVMELALIFGVCLVGIGIAEFLPFTVPYSVLSLLVLTFLLYRK
FT                   ILKPEQIQDAGGFFIRNMGIFFVPAVVGTLEYVETLKNYLVPFLVITLVTTPLVYFITG
FT                   WSVQLCLKLWRKKGTAHV"
FT                   /protein_id="YP_003397927.1"
FT   misc_feature    251010..251375
FT                   /note="LrgA family; Region: LrgA; cl00608"
FT                   /db_xref="CDD:174308"
FT                   /locus_tag="Acfer_0204"
FT   gene            251371..252054
FT                   /db_xref="GeneID:8736644"
FT                   /locus_tag="Acfer_0205"
FT   CDS_pept        251371..252054
FT                   /locus_tag="Acfer_0205"
FT                   /gene_family="HOG000253604" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04172"
FT                   /codon_start="1"
FT                   /product="LrgB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LrgB family protein; KEGG: ele:Elen_2909 LrgB
FT                   family protein"
FT                   /db_xref="GI:284047589"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="GeneID:8736644"
FT                   /translation="MFDTFTRTPFFGLTLIFICWVLGVKFQKKTGWLLCNPVLTSALMI
FT                   VVILTVTGVPLKHFNAGGSIITMLLGPATAVLALNIYQQRKVLQENFLPILVGCTIGSL
FT                   GSIIAALALCHLFGTNSVFSASMLPKSVTTAIALGISENGGGIPGITAGAVVITGIEGA
FT                   VLAPFLGKLFHITDPVAEGVAIGACSHAVGTSKALEIGKIQGAMSSISLCVCGIITTGL
FT                   ALFFM"
FT                   /protein_id="YP_003397928.1"
FT   misc_feature    251422..252051
FT                   /note="LrgB-like family; Region: LrgB; cl00596"
FT                   /db_xref="CDD:174300"
FT                   /locus_tag="Acfer_0205"
FT   gene            252208..253362
FT                   /db_xref="GeneID:8736645"
FT                   /locus_tag="Acfer_0206"
FT   CDS_pept        252208..253362
FT                   /locus_tag="Acfer_0206"
FT                   /gene_family="HOG000275007" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /codon_start="1"
FT                   /product="peptidase dimerization domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: cdf:CD2822 putative peptidase"
FT                   /db_xref="GI:284047590"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="GeneID:8736645"
FT                   /translation="MEQQQEKIREAVESFRQDMLDFWKDLINFQAGSKEKDRMETLMEK
FT                   VSAYLERQGMESELVESGAAPLIRAWSGKERAGQPILLSGHLDTVFPNGSYPADPFTIW
FT                   EGKAYGPGVCDMKGGIVMAVYLARVLEKIGYDRHPIKLLFVPDEEITHQGSRAAQLLAE
FT                   EARGCLCAFNLETGRMDNCLTVGRKGCMDVWITVHGKAGHVGNAYTRSANAIEEMAHKI
FT                   IALRALTDLEKGRIVSTDIISGGTVSNAVADTCRIEVDCRYDYNEDKEKLQEAIRAICA
FT                   ETHVPGTRTEVEFPAFMPVFERTEGNDRLLDLVNQEARAFGIPAFGAAHPGGCSDASFM
FT                   AQAGIPILDSVGVQGDGAHTLQEYAIVETMFERTMLLAAAICRL"
FT                   /protein_id="YP_003397929.1"
FT   misc_feature    252220..253359
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases [Amino acid transport
FT                   and metabolism]; Region: ArgE; COG0624"
FT                   /db_xref="CDD:30969"
FT                   /locus_tag="Acfer_0206"
FT   misc_feature    252223..253359
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0206"
FT   gene            253385..254824
FT                   /db_xref="GeneID:8736646"
FT                   /locus_tag="Acfer_0207"
FT   CDS_pept        253385..254824
FT                   /locus_tag="Acfer_0207"
FT                   /gene_family="HOG000277480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03606"
FT                   /codon_start="1"
FT                   /product="C4-dicarboxylate anaerobic carrier-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier-like; KEGG:
FT                   amt:Amet_0661 C4-dicarboxylate anaerobic carrier"
FT                   /db_xref="GI:284047591"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="GeneID:8736646"
FT                   /translation="MTENKQDTVQKPVNKKVSVPSPIIIIFFILILTAIATYLIPAGAF
FT                   ERVKDAASGRMVVDPNTFHFIARHPAGFFDVFKAVPRGVKGASGIVGFLMIIGGALNVM
FT                   AETGAINGALGHVVTKVKGREMLLIPVMLTIMTCLSTFAGCSEEYIAFVPLIMAVSYAL
FT                   GFDSIVAVALPLAAVSGGYGAGVTNAFTVGVAQSISGLPMFSGIEFRMVMLAVLILINV
FT                   SYTMWYARKIKKNPERSYMYDYDQIYRPQMDLSAYEGENALMTGRQKVIMAGFVVTVAA
FT                   ILVGVIKFGFYMDELAALFLMMAVFAGIVGRLSINTFANAFIGGVKNMAMPCMMVSLCK
FT                   GVTLLMGDSKILDTIIYYLAAGLNVFPHSLLGFGMFIVQDVFNLVVPSGSGQAAITMPI
FT                   MAPLADLVGLTRQTAVLAFQMGDAFTNMITPASGTTMTVLTVAGVPLRRWWKFAFPLLG
FT                   LEWIFAFVVMWYASAIHFGPF"
FT                   /protein_id="YP_003397930.1"
FT   misc_feature    253505..254812
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0207"
FT   misc_feature    253505..254806
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1288"
FT                   /db_xref="CDD:31479"
FT                   /locus_tag="Acfer_0207"
FT   gene            255255..256238
FT                   /db_xref="GeneID:8736647"
FT                   /locus_tag="Acfer_0208"
FT   CDS_pept        255255..256238
FT                   /locus_tag="Acfer_0208"
FT                   /gene_family="HOG000236200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /codon_start="1"
FT                   /product="Bile acid:sodium symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: mmp:MMP0653
FT                   bile acid:sodium symporter"
FT                   /db_xref="GI:284047592"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="GeneID:8736647"
FT                   /translation="MNLLTKVSGFVGKNLTWLVLATIVGGYFVPGAFSWSVHYTVWLLG
FT                   VVMFGMGMTLHVSDFKLVLQRPKEVLAGTVCHYTIMPLVAFALTKVFHLSPDLAVGMVL
FT                   LGSCPSGTASNVMSFLAKGDVPLAVSVTTVSTLLAPVMMPFLVWALAGEYVNVSFVSMA
FT                   LTVMKVILVPLVLGLLVHKVVGEKFLAQVQKVLVLLSAFAVLSILGGVVAVNGAKIVAL
FT                   GAFVVVLVLLHNLAGFGLGYFVTGKLGMGKPQQHSVTLEVGMQNDALALSICAVYFAPA
FT                   VAIPAAVGAAVHQITGSFLAGLFARNMDRYEARQKAAEEASVAVGD"
FT                   /protein_id="YP_003397931.1"
FT   misc_feature    255255..256208
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Acfer_0208"
FT   gene            256239..257078
FT                   /db_xref="GeneID:8736648"
FT                   /locus_tag="Acfer_0209"
FT   CDS_pept        256239..257078
FT                   /locus_tag="Acfer_0209"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047593"
FT                   /db_xref="GeneID:8736648"
FT                   /translation="MKGGLLHEQQPLSFLCYNNPRNRKAGMFMLKKIMLLCCLLGLLLG
FT                   AGCGKEANKTEEVHVASYPGWVEIKAGAQASFSVPPEMILQSQETRDSLLKNPDLDPLL
FT                   KKWLEADQQVVKSPGSVFVQSGKLDPVPWNTDEHLVWVEFRTVASPEKMPRYGQNIGLK
FT                   GNEIKEFGDITRKSLEGVYQKRMPEGYALKFSNWQPMESTIVNGVENLHTSYDMEILRQ
FT                   GQHLMTFHAERWTLFNWDRVHNLTVVWNKADDGYWKEDSHKLTNIINTLKVTPSRGK"
FT                   /protein_id="YP_003397932.1"
FT   gene            257170..258045
FT                   /db_xref="GeneID:8736649"
FT                   /locus_tag="Acfer_0210"
FT   CDS_pept        257170..258045
FT                   /locus_tag="Acfer_0210"
FT                   /gene_family="HOG000219608" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: cpf:CPF_0381 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="GI:284047594"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="GeneID:8736649"
FT                   /translation="MTEIRDIGFIGTGIMGKSMLRNLQKAGYVMHCYARHPEKVADLKE
FT                   KGVAVHDSIAGLAKTCQCVITIVGFPRDVEEVYFAPGALMESAVPGSYLIDMTTTSPTL
FT                   ARKLYEEGTKRGFHVMDAPVTGGDTGARNGTLSILAGGDREDFDTLQPVFQGMGTNINY
FT                   MGEAGMGQHAKMANQIMIAGALSGVCEALRYAQANGLDLEILLKAVSTGAAGSAQLNAF
FT                   GPKIIQGDYAPGFFLKHFIKDMGLAEEEAEKKDLSLPVLHQVLKEYRELAKEGKGDLGT
FT                   QALFTYYEKK"
FT                   /protein_id="YP_003397933.1"
FT   misc_feature    257188..258036
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Acfer_0210"
FT   misc_feature    257188..>257694
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Acfer_0210"
FT   gene            258175..259218
FT                   /db_xref="GeneID:8736650"
FT                   /locus_tag="Acfer_0211"
FT   CDS_pept        258175..259218
FT                   /locus_tag="Acfer_0211"
FT                   /gene_family="HOG000087438" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sth:STH1146 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="GI:284047595"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8736650"
FT                   /translation="MGRKKWLAAAAALLACGTLLLTGCGGGDKKAADGKKGVSGNVMVY
FT                   TSMYPDIVNSMCKPKVQKAFPDLKVSWFQGGTEKIKTKIAGEVKANKISDDVLMVADPS
FT                   YYIYLKNKGLLLDYKSPETKHHIMEVDKDGAWAAVRVCNMIIAYNKDKLKPEDVPTSWQ
FT                   DLTNPKYKGRIAMPNPLLSGTAYVAVGSLADKFGWEYFDALKANGLRVEEGNSAIQNKL
FT                   LTGEYMAAIILEENILKLQQTKKEPLEVVYPKEGCILISSPIGIFKATKNPEGAKALTD
FT                   WWLSKEGQAAVTAGWMHSVRDDVEKPKGAKYSLKELLKNALKVDWEKLTRDESKIKEEF
FT                   RSRVMDA"
FT                   /protein_id="YP_003397934.1"
FT   misc_feature    258361..259215
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Acfer_0211"
FT   gene            259332..261014
FT                   /db_xref="GeneID:8736651"
FT                   /locus_tag="Acfer_0212"
FT   CDS_pept        259332..261014
FT                   /locus_tag="Acfer_0212"
FT                   /gene_family="HOG000296746" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sth:STH1147 ABC transporter
FT                   permease protein"
FT                   /db_xref="GI:284047596"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8736651"
FT                   /translation="MKKWNLPRIDSKSAVIALTVLALLYFIVLPLAVLIWDSVMVDGTF
FT                   DLSSYAAVYSQKVNLKALRNTVEISLLVMLLSVLVTFPLAWLIGRTDLPGRKKFRTILV
FT                   ASYMIPPYVGAIAWTQLLNPDVGYLNQLLKTLFSLSQAPFNIYTRGGMIWVLTLFYSPF
FT                   AFITISRAMEKMDPTLEEASRIAGASPLKALWDVTLPLMAPSILAGGLLVFIGSGSCFG
FT                   IPAIVGMPGNIEVLTTRIVSFVYMGDDQGIRNATTLAVSLMFLANGLLFFMSWLMGRKD
FT                   YTTISGKSTRPVLVELGRWKGLATFFVGLYAFLAVILPLGSIVMTSFMVSMSKGIRLDN
FT                   FGIDAWIPVLENSQYLDCIWRSLGYAFLSACIGTVLALFVAYLSVKTRVPGRSLPDILV
FT                   MVGGSTPSVVIALALIIFFSGNYGLNLYSSMWILIVSYLVKYMTMSVRTIAASLSQVSS
FT                   SLEEAGLNAGADWLRICKDIIMPLIAPSIVAGWFLIFMPSFYELTMSNLLYGSDTQTIG
FT                   VLLYELQTYADTQNASVLSVIILVIVMVGNLILNKVSKGNIAI"
FT                   /protein_id="YP_003397935.1"
FT   misc_feature    259368..261002
FT                   /note="ABC-type Fe3+ transport system, permease component
FT                   [Inorganic ion transport and metabolism]; Region: ThiP;
FT                   COG1178"
FT                   /db_xref="CDD:31371"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    259518..260015
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(259566..259571,259578..259583,259596..259598,
FT                   259626..259637,259641..259670,259677..259682,
FT                   259686..259688,259803..259808,259812..259814,
FT                   259818..259820,259827..259832,259836..259838,
FT                   259848..259853,259860..259862,259911..259913,
FT                   259953..259958,259965..259967,259986..259997,
FT                   260004..260009)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(259644..259688,259986..260003)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(259686..259688,259788..259790,260004..260006)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(259863..259901,259917..259922,259932..259934)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    260406..260909
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(260454..260459,260466..260471,260484..260486,
FT                   260514..260525,260529..260558,260565..260570,
FT                   260574..260576,260643..260648,260655..260657,
FT                   260661..260663,260670..260675,260679..260681,
FT                   260691..260696,260703..260705,260754..260756,
FT                   260796..260801,260808..260810,260829..260840,
FT                   260847..260852,260889..260894)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(260532..260576,260829..260846)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(260574..260576,260628..260630,260847..260849,
FT                   260883..260885,260892..260894)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   misc_feature    order(260706..260744,260760..260765,260775..260777)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0212"
FT   gene            261029..262099
FT                   /db_xref="GeneID:8736652"
FT                   /locus_tag="Acfer_0213"
FT   CDS_pept        261029..262099
FT                   /locus_tag="Acfer_0213"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: tga:TGAM_1014
FT                   ABC-type transport system, ATPase component, putative Fe3+
FT                   transporter (FbpC/AfuC)"
FT                   /db_xref="GI:284047597"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736652"
FT                   /translation="MSQVKLEHLYKRFGSVTAVGDFNLDVADGEFISFLGPSGCGKSTT
FT                   LRMIAGFERPTEGNILLGDTVVSSAESHVFVPPEKRNIGMVFQSYAVWPHMTVGENVAY
FT                   PLKIQKVSREERKKRVEEALEMVHLERYGERYPSQLSGGQQQRVALARALIAQPGLLLL
FT                   DEPLSNLDAKLRESMRFEISSLQKRLGITVIYVTHDQSEAMTMSDRIVVMNAGVVQQVG
FT                   RPYDVYTHPVNKMVADFIGLVNFLPAEVRGDRVFVQGTQVSFPNKENLAQGPAVIGVRP
FT                   ENLTLSKTGGMLQGTVKHRFYMGDAVDYRIQVGGQVLRVMTHGSSYHQWADGEPIYLDL
FT                   ADVILLDNEKSNYVIT"
FT                   /protein_id="YP_003397936.1"
FT   misc_feature    261029..262051
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261038..261751
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261134..261157
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    order(261143..261148,261152..261160,261290..261292,
FT                   261518..261523,261620..261622)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261281..261292
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261446..261475
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261506..261523
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261530..261541
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261608..261628
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0213"
FT   misc_feature    261857..262066
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Acfer_0213"
FT   gene            262270..262650
FT                   /db_xref="GeneID:8736653"
FT                   /locus_tag="Acfer_0214"
FT   CDS_pept        262270..262650
FT                   /locus_tag="Acfer_0214"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: apv:Apar_0245
FT                   endoribonuclease L-PSP"
FT                   /db_xref="GI:284047598"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="GeneID:8736653"
FT                   /translation="MNRQIATPKAPGAIGPYSQAIEASGKTVYVSGQIPIDPATGEFAG
FT                   TDIVTQTRQSLTNVKNILEAAGYTLDDVVKTTVLLSDIADFGPMNEVYGTFFTGVCPAR
FT                   ACFQVAALPKGALVEIEAFACK"
FT                   /protein_id="YP_003397937.1"
FT   misc_feature    262318..262641
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Acfer_0214"
FT   misc_feature    order(262318..262323,262330..262332,262336..262338,
FT                   262348..262350,262354..262356,262360..262365,
FT                   262483..262485,262489..262494,262498..262500,
FT                   262504..262506,262537..262539,262546..262548,
FT                   262573..262596,262624..262626,262630..262632,
FT                   262636..262638)
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Acfer_0214"
FT   misc_feature    order(262318..262320,262525..262527,262537..262539,
FT                   262579..262581,262624..262626)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Acfer_0214"
FT   gene            complement(262772..263524)
FT                   /db_xref="GeneID:8736654"
FT                   /locus_tag="Acfer_0215"
FT   CDS_pept        complement(262772..263524)
FT                   /locus_tag="Acfer_0215"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   reu:Reut_B5545 regulatory protein, IclR"
FT                   /db_xref="GI:284047599"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:8736654"
FT                   /translation="MAETTPAVHSVLHAIRILELYAAQRRESLSLTEISKALGLHKTTV
FT                   YRILRTLQQAGWMEQSAKTGKYYLGTGILLVASAVSVHNTSRDLLSEEMHRLAEKFNET
FT                   VVLSVLLGHTGICADLAKSRHRLGVAGERGYIVPLQSGASGKTLLAAQPEPLREQLLQE
FT                   LEPDRTRQRILKNQLLKIRQDGYCISEGEVDQGVAAIAMPLRLKDNIFVLSISGPVDRL
FT                   RALTYPVLRQGLAETVTRLERKSMLVEE"
FT                   /protein_id="YP_003397938.1"
FT   misc_feature    complement(<263285..263503)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0215"
FT   misc_feature    complement(262793..263497)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Acfer_0215"
FT   misc_feature    complement(262859..263113)
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Acfer_0215"
FT   gene            263715..264683
FT                   /db_xref="GeneID:8736655"
FT                   /locus_tag="Acfer_0216"
FT   CDS_pept        263715..264683
FT                   /locus_tag="Acfer_0216"
FT                   /gene_family="HOG000204320" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /codon_start="1"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /transl_table="11"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   ppg:PputGB1_3103 agmatinase"
FT                   /db_xref="GI:284047600"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="GeneID:8736655"
FT                   /translation="MDNFSLQKPLNMAPTGIATFAKTDLAPDIYNLNADIAVLGAPFDL
FT                   AIQGRTGCRLGPRGIRLGSTRFTYKKGGTYDSERKEFYMDTDKWKVVDCGDADYIPGDL
FT                   TGTMANLREAVRIIQSQGTMPVVLGGDCAVDFPVLQGLEGIGNFDIIHIDAHLDWTKPL
FT                   DGQKYFNGSPMRNAAALPYVGRILHLGIRGIGSSGPEDFAEAREHGDGIYSVRDVRKKG
FT                   IEAILEEFKPAEKAVLCFDIDAMDAVYAPATGSPMFGGFNYDDAVDILEAIARHTELAG
FT                   MVLTEVAPPFDDVGGTTGYLAARLISDMLGFATKAREKKKG"
FT                   /protein_id="YP_003397939.1"
FT   misc_feature    263814..264647
FT                   /note="Arginase family; Region: Arginase; cl00306"
FT                   /db_xref="CDD:174098"
FT                   /locus_tag="Acfer_0216"
FT   gene            264687..265205
FT                   /db_xref="GeneID:8736656"
FT                   /locus_tag="Acfer_0217"
FT   CDS_pept        264687..265205
FT                   /locus_tag="Acfer_0217"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cphy_2765"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_2765 hypothetical protein"
FT                   /db_xref="GI:284047601"
FT                   /db_xref="GeneID:8736656"
FT                   /translation="MTGLQKRRPGQWITMIGFCVAMEVILARFLSLHTWNLKIGFSFLP
FT                   VVAAALWGGPLAGGITGALGDLIGALLFPVGAYFPGFTLSSFLDGAIYGWCFRKGTGKR
FT                   QILLAVLLVQVAISLLLNTFWLTVLFQVSLESLLTLRLFQCAAGIVIKFLLLSLVLPVL
FT                   RKNLVPLGK"
FT                   /protein_id="YP_003397940.1"
FT   misc_feature    264729..>264977
FT                   /note="hypothetical protein; Provisional; Region: PRK09609"
FT                   /db_xref="CDD:170006"
FT                   /locus_tag="Acfer_0217"
FT   gene            complement(265344..265676)
FT                   /db_xref="GeneID:8736657"
FT                   /locus_tag="Acfer_0218"
FT   CDS_pept        complement(265344..265676)
FT                   /locus_tag="Acfer_0218"
FT                   /gene_family="HOG000013920" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid transport"
FT                   /transl_table="11"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   dps:DP2464 hypothetical protein"
FT                   /db_xref="GI:284047602"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="GeneID:8736657"
FT                   /translation="MTPMNQTYILTVVLIMALTGFLPRVIPMAIIRKHPIPQWFKVWLN
FT                   FVPPAIFGALVFPDIFLTEGHLNLSLHNIPLLTTLLITPLVLKTKSLGVAVLAGGGVFA
FT                   LLEYVL"
FT                   /protein_id="YP_003397941.1"
FT   misc_feature    complement(<265476..265652)
FT                   /note="Branched-chain amino acid transport protein (AzlD);
FT                   Region: AzlD; cl00735"
FT                   /db_xref="CDD:153963"
FT                   /locus_tag="Acfer_0218"
FT   gene            complement(265673..266449)
FT                   /db_xref="GeneID:8736658"
FT                   /locus_tag="Acfer_0219"
FT   CDS_pept        complement(265673..266449)
FT                   /locus_tag="Acfer_0219"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /codon_start="1"
FT                   /product="AzlC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: AzlC family protein; KEGG: sfu:Sfum_0194 AzlC
FT                   family protein"
FT                   /db_xref="GI:284047603"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="GeneID:8736658"
FT                   /translation="MGYITRRVLQKDAPIILGYWVLGMACGMLGEKAGLNPFHMFIMSV
FT                   LAFAGSSQFIGIAMMLQSASYISIALTILMVNLRYSLFTSTLAPLVARKSGLYTTLFSY
FT                   GTTDETFALNLSSFQDEEEHWTHEEALGLDLLSMVVWAIANAFGCYASRLVHLDLSLVS
FT                   YILTAMFLGIWSNYLKNRTMIITGLAAGVLAVLLSQVVPYKLHIVLASLIPSGIAAWLY
FT                   MKHGGKGASPSEEGEKLSETDDEEVYGTMEEGGSDV"
FT                   /protein_id="YP_003397942.1"
FT   misc_feature    complement(265985..266413)
FT                   /note="AzlC protein; Region: AzlC; cl00570"
FT                   /db_xref="CDD:153863"
FT                   /locus_tag="Acfer_0219"
FT   gene            266632..267897
FT                   /db_xref="GeneID:8736659"
FT                   /locus_tag="Acfer_0220"
FT   CDS_pept        266632..267897
FT                   /locus_tag="Acfer_0220"
FT                   /gene_family="HOG000088854" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   kol:Kole_1784 hypothetical protein"
FT                   /db_xref="GI:284047604"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="GeneID:8736659"
FT                   /translation="MAEIRPFAALRPVPELVSQIAELPYDVMSTQEARDILKKDPLSFV
FT                   RVSRAEADLPEGIAESDPRVYAKARENLEDYMAKGQMRQDPQPCYYIYRQQMGAYIQIG
FT                   LVAAASLKEYKEGIIKRHELTRQVKETDRVNHIMATKAQTGPVFLAYRSKGLLTAFLLE
FT                   YMGSHTPAYNFVGDDKIRHTLYVISEPLKVKEVTRLFQQVPELYIADGHHRCAAALRVA
FT                   EELAKRPNQTGKEEYNYVLSVIFPSNMLHILPYNRIVRDLGELSEEKFLEMVQENFLLE
FT                   KDDRPVEPQAPHTFGMYISGQWYRLTAKPDTYPTDDPIHSLDVSILQDNLLAPVLGIDD
FT                   PRTDPRIDFVGGVRGLSALEDAVDGEDATVAFSLYPTSMDQLMTVADKGLVMPPKSTWF
FT                   EPKLRDALTVHMIGDEQDGKNL"
FT                   /protein_id="YP_003397943.1"
FT   misc_feature    266638..267867
FT                   /note="Protein of unknown function (DUF1015); Region:
FT                   DUF1015; cl01715"
FT                   /db_xref="CDD:154549"
FT                   /locus_tag="Acfer_0220"
FT   gene            267881..268966
FT                   /db_xref="GeneID:8736660"
FT                   /locus_tag="Acfer_0221"
FT   CDS_pept        267881..268966
FT                   /locus_tag="Acfer_0221"
FT                   /gene_family="HOG000088965" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01364"
FT                   /codon_start="1"
FT                   /EC_number="2.6.1.52"
FT                   /transl_table="11"
FT                   /note="KEGG: hmo:HM1_2036 phosphoserine aminotransferase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V"
FT                   /db_xref="GI:284047605"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR003248"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8736660"
FT                   /translation="MGRIFNFGAGPSMMPLPVLEQAQRELLDYKGSGMSMLEISHRSPL
FT                   FEEVNDQAQAHIKELLGMDDSWAVMFMGGGATLQFSMIPMNFLTPGKTAAYAITSTFSE
FT                   KAIKEAQKVGNAVEIYSSKATGLDRVPRPEELVLPDNCAYLHLTGNCTAEGLEYFEYPD
FT                   TGDVPLIVDMSSDILSRPIPLDKFSLIYNGAQKNIGPAGVTVVMAKKDFLKGRDPQLPI
FT                   MMNYETYADHDSTYNTPPVFGIYLVDLMSQWLLDQGGLEKVEQRNIAKAKMVYDVLDAH
FT                   PDFYKGHAQKDSRSLMNVTFNLPTKDMEAQFVEESKAQGLAGLKGHRAVGGIRASIYNA
FT                   MPLEGVQALVDFMEDFWKKNR"
FT                   /product="phosphoserine aminotransferase"
FT                   /protein_id="YP_003397944.1"
FT   misc_feature    267893..268954
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176925"
FT                   /locus_tag="Acfer_0221"
FT   misc_feature    order(268106..268111,268118..268120,268322..268324,
FT                   268394..268396,268403..268405,268457..268459,
FT                   268466..268468)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0221"
FT   misc_feature    268466..268468
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Acfer_0221"
FT   gene            268979..270235
FT                   /db_xref="GeneID:8736661"
FT                   /locus_tag="Acfer_0222"
FT   CDS_pept        268979..270235
FT                   /locus_tag="Acfer_0222"
FT                   /gene_family="HOG000282013" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00210"
FT                   /codon_start="1"
FT                   /product="sodium/glutamate symporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sodium/glutamate symporter; PFAM:
FT                   sodium/glutamate symporter; KEGG: fnu:FN1801
FT                   sodium/glutamate symport carrier protein"
FT                   /db_xref="GI:284047606"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="GeneID:8736661"
FT                   /translation="MFISLTEGILTIRADGICTTALAAVMLLLGVWLKAHSRLLRKYCL
FT                   PAPVVGGTLAMLLVFLGHETGLFQIEFDTQFQIPFMISFFTAVGLGAKLSAFSKGVNKG
FT                   GKLLLIYWLITAFISLCQNLIGLLVGHLIGLEPAYALLSSAISMVGGHGAAGAYGSTFL
FT                   KMGYPASMEVGASAATFGLIAAVMSGGPMGRFLIEKYHLRPEAEKEAPEVPEKPKDTDL
FT                   TYQQLAKLDILINVSAILICMGLGVWLAQGVGSLLNMTFPSYVCAMFVGVLVRNLNEQF
FT                   HFYQFSESLVGSFGEIMLNLYLAIVLMSLKLWEMAGILSGVMLIVLAHVAFMLLMCYFV
FT                   VFRVLGSNYDAAVMCAGLCGHGLGAVPSAMVNMTVLADQYGVSRKAFLIVPVVGSCLAD
FT                   LAYQPHTLLLIKLFVENLN"
FT                   /protein_id="YP_003397945.1"
FT   misc_feature    269006..270184
FT                   /note="Na+/glutamate symporter [Amino acid transport and
FT                   metabolism]; Region: GltS; cl12073"
FT                   /db_xref="CDD:159733"
FT                   /locus_tag="Acfer_0222"
FT   misc_feature    269012..270124
FT                   /note="Sodium/glutamate symporter; Region: Glt_symporter;
FT                   pfam03616"
FT                   /db_xref="CDD:112434"
FT                   /locus_tag="Acfer_0222"
FT   gene            270469..271023
FT                   /db_xref="GeneID:8736662"
FT                   /locus_tag="Acfer_0223"
FT   CDS_pept        270469..271023
FT                   /locus_tag="Acfer_0223"
FT                   /gene_family="HOG000275355" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /codon_start="1"
FT                   /product="LemA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LemA family protein; KEGG: dhd:Dhaf_0874 LemA
FT                   family protein"
FT                   /db_xref="GI:284047607"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="GeneID:8736662"
FT                   /translation="MKKSLVVFFAVVLLLAGWIFGSYNGVVTANENVNGKWSQVETQLQ
FT                   RRSDLIPNLVNTVKGYSAHESQVFTDVANARARLAGARNVTEAAQANGELSGALSRLLA
FT                   ISENYPQLKANTNFIQLQDELAGTENRLAVARKDYNDAAQAYNAKIKSFPTVLVARMMG
FT                   FQERSYFKADPQAQKAPQVKF"
FT                   /protein_id="YP_003397946.1"
FT   misc_feature    270517..271020
FT                   /note="LemA family; Region: LemA; cl00742"
FT                   /db_xref="CDD:120079"
FT                   /locus_tag="Acfer_0223"
FT   gene            271054..271833
FT                   /db_xref="GeneID:8736663"
FT                   /locus_tag="Acfer_0224"
FT   CDS_pept        271054..271833
FT                   /locus_tag="Acfer_0224"
FT                   /gene_family="HOG000295055" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF477"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   dhd:Dhaf_0875 protein of unknown function DUF477"
FT                   /db_xref="GI:284047608"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="GeneID:8736663"
FT                   /translation="MKRLLLFLVLVCQMVFAPLQAGAAAQVPPRPTASIYVQDQAGVLS
FT                   RNTRDTISAYSTALARKTKAQIVVLTVPSLRGQSLEDYSLTVLRQWGIGDKEKNNGVLL
FT                   LVAVQDRKSRIEVGYGLEGALPDGLTGRIQDQAMLPYFRQGDYDRGILNAYSAILQTVL
FT                   KEYNLTPQDLPVQKALPAKQGDTVTISPLMAGIGLLGILILFLLDRVLLGGALFRFLFY
FT                   LFFFRGGGRGGGFGGGGFGGGSYGGGSGGGGGSSRSW"
FT                   /protein_id="YP_003397947.1"
FT   misc_feature    271054..>271563
FT                   /note="Domain of unknown function (DUF477); Region: DUF477;
FT                   cl01535"
FT                   /db_xref="CDD:154459"
FT                   /locus_tag="Acfer_0224"
FT   gene            complement(272138..273559)
FT                   /db_xref="GeneID:8736664"
FT                   /locus_tag="Acfer_0225"
FT   CDS_pept        complement(272138..273559)
FT                   /locus_tag="Acfer_0225"
FT                   /gene_family="HOG000287506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /codon_start="1"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /transl_table="11"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; KEGG: bvu:BVU_0349 thiamine
FT                   biosynthesis protein ThiH"
FT                   /db_xref="GI:284047609"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736664"
FT                   /translation="MTIPYNPASPKAEEFINHQEILDTLAFADERSKDPDYCRSLLEKA
FT                   RTLKGLTHREASVLLACEDPSILEGIYDLAREIKDKIYGQRIVLFAPLYLSNYCVNGCV
FT                   YCPYHMKNKHIARKKLTQDEIRKEVIALQDMGHKRLALEAGEDPVNNPIDYILECIHTI
FT                   YSIKHKNGAIRRVNVNIAATTVENYRKLKEAGIGTYILFQETYHKENYEKLHPTGPKHD
FT                   YAYHTEAMDRAMEGGIDDVGVGVLFGLNMYRYDFAGILMHKEHLETMFGVGPHTISVPR
FT                   IRPADDISVQSFPNAISDAMFKKIVAILRITVPYTGIIISTRESAATRKAVLEVGVSQI
FT                   SGASRTSVGGYAEEEEEDSAQFEVSDNRTLDQVINWLLTDGYIPSFCTACYRAGRTGDR
FT                   FMSLAKTGEISNCCQPNALLTLREYLDDYASPETRQKGMEAIKKELNHIPNPQVRATCE
FT                   AYLQKIDGGERDFRF"
FT                   /protein_id="YP_003397948.1"
FT   misc_feature    complement(272141..273550)
FT                   /note="thiamine biosynthesis protein ThiH; Reviewed;
FT                   Region: thiH; PRK09613"
FT                   /db_xref="CDD:170008"
FT                   /locus_tag="Acfer_0225"
FT   misc_feature    complement(272708..273283)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0225"
FT   misc_feature    complement(order(272714..272719,272825..272827,
FT                   272954..272956,273023..273031,273122..273127,
FT                   273131..273133,273239..273247,273251..273253,
FT                   273257..273259,273263..273265))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Acfer_0225"
FT   misc_feature    complement(272408..272728)
FT                   /note="Biotin and Thiamin Synthesis associated domain;
FT                   Region: BATS; cl06149"
FT                   /db_xref="CDD:157061"
FT                   /locus_tag="Acfer_0225"
FT   gene            complement(273899..274426)
FT                   /db_xref="GeneID:8736665"
FT                   /locus_tag="Acfer_0226"
FT   CDS_pept        complement(273899..274426)
FT                   /locus_tag="Acfer_0226"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047610"
FT                   /db_xref="GeneID:8736665"
FT                   /translation="MGHQNKIAKAIVAGLVVASSFGMVAPVMAAPAVKSTIASKQAAID
FT                   AAAKVVPPEAVLTSAKTDDAKFDLEYLVPDTLQRYEIVVDRATSKVQSAVIKTSNYPGS
FT                   VTVSKTEADVKGTILADYPDAKNIVVTKYTDDKSGTPFVIYKATFETATLTGTALLNPA
FT                   TALIGYQELKFK"
FT                   /protein_id="YP_003397949.1"
FT   gene            complement(274627..274703)
FT                   /note="tRNA-Arg4"
FT                   /db_xref="GeneID:8736666"
FT                   /locus_tag="Acfer_R0010"
FT   tRNA            complement(274627..274703)
FT                   /db_xref="GeneID:8736666"
FT                   /locus_tag="Acfer_R0010"
FT                   /product="tRNA-Arg"
FT   gene            274889..276166
FT                   /db_xref="GeneID:8736667"
FT                   /locus_tag="Acfer_0227"
FT   CDS_pept        274889..276166
FT                   /locus_tag="Acfer_0227"
FT                   /gene_family="HOG000019083" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02729"
FT                   /codon_start="1"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; small GTP-
FT                   binding protein; Obg family GTPase CgtA; PFAM: GTP1/OBG sub
FT                   domain protein; GTP-binding protein HSR1-related; GTP1/OBG
FT                   domain protein; KEGG: chy:CHY_0370 GTPase ObgE"
FT                   /db_xref="GI:284047611"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="GeneID:8736667"
FT                   /translation="MLFTDKARIYVEAGSGGDGASSFRREKYVACGGPDGGNGGRGGSV
FT                   VLVADKDLNTLVDFRYKRKFVAQRGGNGAAKNCTGAKAPNVEVKVPLGTVVYDDATGVA
FT                   LADLAHPGDQFVAARGGRGGKGNACYVTSTKQGVTFAEKGEPGTKGWLRLELKMLADVG
FT                   MVGYPSVGKSSIVARVSAARPEVAAYHFTTLTPVLGVVRLDAETSFVLADLPGLIEGAS
FT                   QGVGLGHDFLRHIERTRVILHVVDVSGCEGRDPVEDFKKINEELVLYSEKLAKRPMLVV
FT                   ANKMDLPDAEENYKKLEAYVTAQGYPIMKASAATSQGLREIMWKAYEMLQKAPAEEEII
FT                   DIGKVDEADPDSFTILRDTEDADFEVKGKNIERLVAMTNFDNEEAVYRFQLIWRRLGIE
FT                   KALKEKGIQEGQSVKIGDMVFDYQEQ"
FT                   /protein_id="YP_003397950.1"
FT   misc_feature    274895..276160
FT                   /note="GTPase ObgE; Reviewed; Region: obgE; PRK12297"
FT                   /db_xref="CDD:171380"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    274895..275359
FT                   /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
FT                   /db_xref="CDD:110047"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275366..275878
FT                   /note="Obg subfamily.  The Obg nucleotide binding protein
FT                   subfamily has been implicated in stress response,
FT                   chromosome partitioning, replication initiation, mycelium
FT                   development, and sporulation.  Obg proteins are among a
FT                   large group of GTP binding proteins...; Region: Obg;
FT                   cd01898"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275384..275407
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    order(275393..275410,275735..275740,275744..275746,
FT                   275822..275827)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275429..275476
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275465..275467
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275525..275536
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    order(275534..275557,275564..275602)
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275735..275746
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275822..275830
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133298"
FT                   /locus_tag="Acfer_0227"
FT   misc_feature    275948..276154
FT                   /note="Domain of unknown function (DUF1967); Region:
FT                   DUF1967; cl07779"
FT                   /db_xref="CDD:164101"
FT                   /locus_tag="Acfer_0227"
FT   gene            276206..277351
FT                   /db_xref="GeneID:8736668"
FT                   /locus_tag="Acfer_0228"
FT   CDS_pept        276206..277351
FT                   /locus_tag="Acfer_0228"
FT                   /gene_family="HOG000246368" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /codon_start="1"
FT                   /EC_number="2.7.2.11"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_0834 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="GI:284047612"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="GeneID:8736668"
FT                   /translation="MHRGVDAMDRSKIAEVKRVVVKVGTSTITYPNGKINYEKIEKLAR
FT                   IMTDLQNQGKEMILVSSGAGAAGVGRMGLEAKPASIPGKQACAAVGQGILMHIYERLFG
FT                   EYGQVVAQVLLTKSDMVNRHSYANARNALQEMISWGVIPIINENDVVAIDEFKIGDNDN
FT                   LSALVASLADADLDILLSDIDGLYTANPKTHPEARLVSVVEEVTPEIEATAGGAGSKNA
FT                   TGGMLTKLQAAKNAMSAGIALIIANGEDLEILRKIMRGEPVGTLFVPRESHLRFRNQWL
FT                   AFGSRISGKVIVDEGLAKALRQKGGCSILPVGITGVEGSFESGDTVSVLDQEGHELARG
FT                   MTNYNAEDLDLIKGCRTSQIEEKIGYKHYDEAIHRDNLVVL"
FT                   /product="glutamate 5-kinase"
FT                   /protein_id="YP_003397951.1"
FT   misc_feature    276233..277348
FT                   /note="gamma-glutamyl kinase; Provisional; Region:
FT                   PRK05429"
FT                   /db_xref="CDD:168042"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    276257..277009
FT                   /note="AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes
FT                   glutamate-dependent ATP cleavage; G5K transfers the
FT                   terminal phosphoryl group of ATP to the gamma-carboxyl
FT                   group of glutamate, in the first and controlling step of
FT                   proline (and, in mammals, ornithine)...; Region:
FT                   AAK_G5K_ProB; cd04242"
FT                   /db_xref="CDD:58608"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    order(276281..276283,276746..276754,276761..276766,
FT                   276872..276874,276878..276880,276890..276892)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:58608"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    order(276356..276361,276368..276370,276458..276460,
FT                   276470..276472,276539..276541,276545..276547,
FT                   276587..276592,276608..276610,276617..276619,
FT                   276647..276649,276653..276658)
FT                   /note="homotetrameric interface; other site"
FT                   /db_xref="CDD:58608"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    276392..276415
FT                   /note="putative phosphate binding site; other site"
FT                   /db_xref="CDD:58608"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    order(276395..276397,276650..276652,276683..276685)
FT                   /note="putative allosteric binding site; other site"
FT                   /db_xref="CDD:58608"
FT                   /locus_tag="Acfer_0228"
FT   misc_feature    277070..277297
FT                   /note="PUA domain; Region: PUA; cl00607"
FT                   /db_xref="CDD:153884"
FT                   /locus_tag="Acfer_0228"
FT   gene            277365..278621
FT                   /db_xref="GeneID:8736669"
FT                   /locus_tag="Acfer_0229"
FT   CDS_pept        277365..278621
FT                   /locus_tag="Acfer_0229"
FT                   /gene_family="HOG000246356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /codon_start="1"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: mta:Moth_0563 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="GI:284047613"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="GeneID:8736669"
FT                   /translation="MYEVGMVRTQGEAAKQASLELGILNTRVKNDILESMAEGLLAEEK
FT                   NILEANAVDMEEGRKGGLRDSLLDRLLLTHDRLAQMAEGIRQVAGLPDPVGRILSGSTL
FT                   ANGLTITKVSVPLGVIGIIYEARPNVTADAIALCVKSGNAVILKGGREALHSNKAVSDV
FT                   LIAYGEKAGLPKGAVQFVNVPDRAAVDELIHLEGLVDVVIPRGGAGLIKNVVHNASVPV
FT                   IETGAGVCHTYVDAYANVPMAVEIAMNAKVNRPSTCNAMETLLVHKDIADAFLPAMLEA
FT                   YKKAHVTVLGDARTQGYSGDVQPATEEDWATEYGDLRLSVKVVDSLEEAVAHIRRYSTG
FT                   HSEAIVTDDYENARKFQQLVDAAAVYVNASTRFTDGFEFGFGAEIGISTQKLHARGPMG
FT                   LPELTTTKYLVNGNGQVRK"
FT                   /protein_id="YP_003397952.1"
FT   misc_feature    277386..278603
FT                   /note="Gamma-glutamyl phosphate reductase (GPR), aldehyde
FT                   dehydrogenase families 18 and 19; Region:
FT                   ALDH_F18-19_ProA-GPR; cd07079"
FT                   /db_xref="CDD:143398"
FT                   /locus_tag="Acfer_0229"
FT   misc_feature    277404..278585
FT                   /note="gamma-glutamyl phosphate reductase; Region: proA;
FT                   TIGR00407"
FT                   /db_xref="CDD:161862"
FT                   /locus_tag="Acfer_0229"
FT   misc_feature    278136..278138
FT                   /note="putative catalytic cysteine; other site"
FT                   /db_xref="CDD:143398"
FT                   /locus_tag="Acfer_0229"
FT   gene            278809..279879
FT                   /db_xref="GeneID:8736670"
FT                   /locus_tag="Acfer_0230"
FT   CDS_pept        278809..279879
FT                   /locus_tag="Acfer_0230"
FT                   /gene_family="HOG000106726" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ppd:Ppro_3233 RND family efflux transporter MFP subunit"
FT                   /db_xref="GI:284047614"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8736670"
FT                   /translation="MNIVQKHKVLLIVLAILVAGGAGGYKYYQVKKTQEAVAATRTDAV
FT                   QRGDLRKTISATGALKALDNVDINSKITGRIVQVYVTENQHVTAGQALVKLDDTSLKAT
FT                   QEMKRAALVDKQATYERDQALLEQGAIAQSVFDTAEANYRVAKAEYEQATSNVNDTVIS
FT                   TPIDGYVIGKPTPVGQTVSSGISTPQVLMSVANLDKMQIYLMVDESDIGQIKQGQTVEF
FT                   TVDTYPNETFKGTISLIGRSATTTNNVNYYTCYVDVENSEGKLLPTMTARANVIVDEIQ
FT                   DALTVSNKCIHTENGQKYVLVYDKENNTSRKVPVKVLLTGEDRVAVQGDLQPGDELVVK
FT                   TAKATGSTNRRMGPPI"
FT                   /protein_id="YP_003397953.1"
FT   misc_feature    278938..279825
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="Acfer_0230"
FT   misc_feature    <279679..279828
FT                   /note="putative membrane fusion protein; Region: TIGR02828"
FT                   /db_xref="CDD:131875"
FT                   /locus_tag="Acfer_0230"
FT   gene            279899..280597
FT                   /db_xref="GeneID:8736671"
FT                   /locus_tag="Acfer_0231"
FT   CDS_pept        279899..280597
FT                   /locus_tag="Acfer_0231"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cth:Cthe_1763 ABC transporter related protein"
FT                   /db_xref="GI:284047615"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736671"
FT                   /translation="MNVIELKDIVKSYQMGDTIVYALNHVTVNFEKGKFTSIVGPSGSG
FT                   KSTMMNILGCLDRPTSGEYYLEGKNIANYTDDELARTRNRRIGFVFQSFNLLSRLTAVE
FT                   NVALPLIYAGVNLEERTRRAEQALTNVGLGTRMYHKPNEMSGGQRQRVAIARALINNPA
FT                   IIMADEPTGNLDTKSTLEIIDIFEKLNQEGKTVIMVTHEPELAAMTQRILVMRDGRLTE
FT                   EKEGGGQVVV"
FT                   /protein_id="YP_003397954.1"
FT   misc_feature    279905..280570
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    279908..280558
FT                   /note="This family is comprised of MJ0796 ATP-binding
FT                   cassette, macrolide-specific ABC-type efflux carrier
FT                   (MacAB), and proteins involved in cell division (FtsE), and
FT                   release of liporoteins from the cytoplasmic membrane
FT                   (LolCDE).  They are clustered together...; Region:
FT                   ABC_MJ0796_Lo1CDE_FtsE; cd03255"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280016..280039
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    order(280025..280030,280034..280042,280172..280174,
FT                   280400..280405,280499..280501)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280163..280174
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280328..280357
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280388..280405
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280412..280423
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   misc_feature    280487..280507
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="Acfer_0231"
FT   gene            280590..281804
FT                   /db_xref="GeneID:8736672"
FT                   /locus_tag="Acfer_0232"
FT   CDS_pept        280590..281804
FT                   /locus_tag="Acfer_0232"
FT                   /gene_family="HOG000208217" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF214"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sat:SYN_01995 export ABC transporter permease protein"
FT                   /db_xref="GI:284047616"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="GeneID:8736672"
FT                   /translation="MFRECVKMAFEGMLANKIRTFLTMLGIIIGVGAVIAMVSLGLGMQ
FT                   EKVKENITSMGSNLLIVMSGGRTANGQRIASGSGAKLTYEDAKAIEKNVDGIKYVAPGV
FT                   QNSYQLVAGNQNWTSQVQGVTPNILSIRSYSIEQGRMYSQRDMNSRERVCVIGKTVADT
FT                   LFPDGNAVGQIMRINKAPFTVIGVLASKGQSAMGQDQDDIVFVPLTTAMQRLMGLTYIR
FT                   NITIQCENENTVSQVQSDVVTLLRTRHKIKTGADDDFSVRDLTEIIKTAQETTGSITLL
FT                   LAIVAGISLLVGGIGIMNIMLVSVTERTREIGIRKALGATYHDILLQFLVESMVIGVTG
FT                   GTTGMILGTVISVIAAKIIGWPIVISIAATIISVVFSVGIGLFFGLYPAKKAALLDPID
FT                   ALRYE"
FT                   /protein_id="YP_003397955.1"
FT   misc_feature    <280593..281801
FT                   /note="macrolide transporter ATP-binding /permease protein;
FT                   Provisional; Region: PRK10535"
FT                   /db_xref="CDD:170510"
FT                   /locus_tag="Acfer_0232"
FT   misc_feature    281343..>281588
FT                   /note="Predicted permease; Region: FtsX; cl11418"
FT                   /db_xref="CDD:175245"
FT                   /locus_tag="Acfer_0232"
FT   gene            281785..281964
FT                   /db_xref="GeneID:8736673"
FT                   /locus_tag="Acfer_0233"
FT   CDS_pept        281785..281964
FT                   /locus_tag="Acfer_0233"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047617"
FT                   /db_xref="GeneID:8736673"
FT                   /translation="MPCVMNKAEKPTLRQKWRGFVEFLHRPKTRFDIRDRGRALVLFLL
FT                   IVAGLMWVVEKITG"
FT                   /protein_id="YP_003397956.1"
FT   gene            complement(282021..282584)
FT                   /db_xref="GeneID:8736674"
FT                   /locus_tag="Acfer_0234"
FT   CDS_pept        complement(282021..282584)
FT                   /locus_tag="Acfer_0234"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05962"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF886"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   tde:TDE2575 hypothetical protein"
FT                   /db_xref="GI:284047618"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="GeneID:8736674"
FT                   /translation="MDILKRSRSQAVTTRWSGGTTTEFYIDPPGSAYARRDFLIRISSA
FT                   TVDLEASDFTLLPDYNRIILPLRGGFTLTFPEDGNRQVTLGPLEQASFDGAWHTHSVGK
FT                   AVDFNVMVRKGHTGTCEKVTGSRLLQPASRRFVYVPFLTDAQLKGAVLDGKPLEQDTLY
FT                   VLPPEGSCGLTLPEGTPVLYIVVE"
FT                   /protein_id="YP_003397957.1"
FT   misc_feature    complement(<282231..282551)
FT                   /note="HutD; Region: HutD; cl01532"
FT                   /db_xref="CDD:154456"
FT                   /locus_tag="Acfer_0234"
FT   gene            282786..283691
FT                   /db_xref="GeneID:8736675"
FT                   /locus_tag="Acfer_0235"
FT   CDS_pept        282786..283691
FT                   /locus_tag="Acfer_0235"
FT                   /gene_family="HOG000235616" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02024"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.4"
FT                   /transl_table="11"
FT                   /note="KEGG: ctc:CTC02305 glutamate formiminotransferase;
FT                   TIGRFAM: glutamate formiminotransferase; PFAM:
FT                   Formiminotransferase domain protein; Formiminotransferase
FT                   domain protein"
FT                   /db_xref="GI:284047619"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="GeneID:8736675"
FT                   /translation="MAKKLVEFVPNFSEGRDKEKVEKIVDEARKIKGLKILDYSSDADH
FT                   NRSVVTIIGSPEAVTEAAINMAKVAIQLIDMRTHHGAHPRFGAVDVVPFTPVMGVTMDE
FT                   CVAIANAVGKAYGEMGIPVYLYEDACTKEARRNLAAVRKGQYEGFFEKIKDPEWKPDYG
FT                   PAVMNEKSGCSAVGARVPLVAFNVNLDCSDKAVADAIAKKVRNIGGGLHYVKAMGVKLE
FT                   ERNQVQVSMNLVNYEKSAVYQAFEMIKMEARRYGVNVVGSEVIGTVPMKALLMAAEYYL
FT                   QIENFNLDEILEKRLLELEE"
FT                   /product="glutamate formiminotransferase"
FT                   /protein_id="YP_003397958.1"
FT   misc_feature    282795..283646
FT                   /note="glutamate formiminotransferase; Region: FtcD;
FT                   TIGR02024"
FT                   /db_xref="CDD:131079"
FT                   /locus_tag="Acfer_0235"
FT   misc_feature    282795..283322
FT                   /note="Formiminotransferase domain, N-terminal subdomain;
FT                   Region: FTCD_N; pfam07837"
FT                   /db_xref="CDD:149095"
FT                   /locus_tag="Acfer_0235"
FT   misc_feature    283329..>283640
FT                   /note="Formiminotransferase domain; Region: FTCD;
FT                   pfam02971"
FT                   /db_xref="CDD:111818"
FT                   /locus_tag="Acfer_0235"
FT   gene            283719..285389
FT                   /db_xref="GeneID:8736676"
FT                   /locus_tag="Acfer_0236"
FT   CDS_pept        283719..285389
FT                   /locus_tag="Acfer_0236"
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:6.3.4.3"
FT                   /codon_start="1"
FT                   /EC_number="6.3.4.3"
FT                   /transl_table="11"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   ctc:CTC02304 formate--tetrahydrofolate ligase"
FT                   /db_xref="GI:284047620"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="GeneID:8736676"
FT                   /translation="MLSDIEIAQKNVMEPISKIADKVGILPEELEQYGHYKAKISLDVL
FT                   KRLEKKPDGKLVLVTAITPTPAGEGKSTTSIGLAQALNRVGKKAVVALREPSLGPVFGI
FT                   KGGAAGGGYAQVVPMDDINLHFTGDMHAITAANNLLSAMIDNHIHHGNELRLDARQITW
FT                   RRVMDMNDRALRNVVVGLGGKVCGFPRQDAFTITVASEIMAILCLAKDLEDLKARFGRI
FT                   VIGCDLDGNPVHVHQLGCEGAMAMLMKDAIKPNLVQTLEHTPAIIHGGPFANIAHGCNS
FT                   LLATKMALKLGDIAITEAGFGADLGAEKFMDIKCHYGNLYPDAVVLVATIRALKMHGGV
FT                   AKADLSQENVQAVSDGFSNLAKQVENMRTFGLPVLVAINKFATDTPAEIDMLLQKCASY
FT                   GVEVSLNECWEKGGEGGIDMANKLVAMLEEQKPQKVELYDVNDTIPNKLKAIVTKIYGG
FT                   DGVTFTPNAKKQIKQLEDWGLDKLPVCVAKTQYSLSDNPALLGAPKGFKINVQDVRVSN
FT                   GAGFIVCQTSNIMVMPGLPKKPAALKMDIDNNGKIYGLF"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /protein_id="YP_003397959.1"
FT   misc_feature    283719..285386
FT                   /note="formate--tetrahydrofolate ligase; Provisional;
FT                   Region: PRK13505"
FT                   /db_xref="CDD:172092"
FT                   /locus_tag="Acfer_0236"
FT   misc_feature    283770..285338
FT                   /note="Formyltetrahydrofolate synthetase (FTHFS) catalyzes
FT                   the ATP-dependent activation of formate ion via its
FT                   addition to the N10 position of tetrahydrofolate. FTHFS is
FT                   a highly expressed key enzyme in both the Wood-Ljungdahl
FT                   pathway of autotrophic CO2...; Region: FTHFS; cd00477"
FT                   /db_xref="CDD:73210"
FT                   /locus_tag="Acfer_0236"
FT   misc_feature    order(284001..284003,284103..284105)
FT                   /note="Potassium binding sites; other site"
FT                   /db_xref="CDD:73210"
FT                   /locus_tag="Acfer_0236"
FT   misc_feature    order(284001..284006,284082..284090)
FT                   /note="Cesium cation binding sites; other site"
FT                   /db_xref="CDD:73210"
FT                   /locus_tag="Acfer_0236"
FT   gene            285409..286029
FT                   /db_xref="GeneID:8736677"
FT                   /locus_tag="Acfer_0237"
FT   CDS_pept        285409..286029
FT                   /locus_tag="Acfer_0237"
FT                   /gene_family="HOG000057022" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.3.1.4"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.4"
FT                   /transl_table="11"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   ctc:CTC02303 formiminotetrahydrofolate cyclodeaminase"
FT                   /db_xref="GI:284047621"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="GeneID:8736677"
FT                   /translation="MELRKLTVEGFINETASSSPAPGGGSIAALNASSSAALIAMVANL
FT                   TLGKEKYAAVEGDMKEVAAKATALKDDFLALIDEDSNAFNKIMAAFKMPKDTDEAKKAR
FT                   SAAIQDATKGAALVPFKVGQKANELFALAETVITKGNQNAITDGAVAAMNARAAVRGAF
FT                   LNVKINLGSIKDALFVEDLKKRMAEIEKEVDAREKALLDQVKL"
FT                   /product="Formimidoyltetrahydrofolate cyclodeaminase"
FT                   /protein_id="YP_003397960.1"
FT   misc_feature    285424..285951
FT                   /note="Formiminotransferase-cyclodeaminase; Region: FTCD_C;
FT                   cl01350"
FT                   /db_xref="CDD:154348"
FT                   /locus_tag="Acfer_0237"
FT   gene            286125..287702
FT                   /db_xref="GeneID:8736678"
FT                   /locus_tag="Acfer_0238"
FT   CDS_pept        286125..287702
FT                   /locus_tag="Acfer_0238"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dsy:DSY1297 hypothetical protein"
FT                   /db_xref="GI:284047622"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8736678"
FT                   /translation="MKNLTVYYGTPKQGILPAFFSECLDITDPVFTFDRFMEEIDLRKY
FT                   LSKLPAHELGRIRYNPINMLKTVLFGFMDEGCISLRKLEDNCKVNIRYKYLMDGKHPSY
FT                   RTFGYFINTVLMNQAESLFYEITQEIITKEHVDLDHLYIDGSKFEANANKYSWVWKKGT
FT                   EKSRFRLFAKISALLEEINEMLSCGGLKAENNSEYAPEYLELILSKLHEIWELDEERFA
FT                   HGKGHHKSPEQRNYEKLKVYLQKLKEYGKKLSICGENRNSYSKTDHSATFMRIKRDYMG
FT                   NDQLLPAYNVQVGIADEYIAVLDVNQYRSDMDCFVPLLEKFYEHHGIYPKYPVADAGYG
FT                   SFNNYLYCSEHGMEACMKFPMFFKETTDKKYHEDPFRAVNFKTTVDGALLCPNGKKFKF
FT                   VYRKNIQGNQYGRQEEIYECEDCNGCPYAERCKKTPHNRRISLNRELTKVHADVIGRLT
FT                   DTRGFLLRRNRAIQAEGTFGVMKNDREYDRIVRRGMDSVKMEVFLVSIGFNLYKYHRKQ
FT                   QAHMDMAA"
FT                   /protein_id="YP_003397961.1"
FT   misc_feature    286152..286619
FT                   /note="Transposase domain (DUF772); Region: DUF772;
FT                   cl12084"
FT                   /db_xref="CDD:159744"
FT                   /locus_tag="Acfer_0238"
FT   gene            complement(287845..288576)
FT                   /db_xref="GeneID:8736679"
FT                   /locus_tag="Acfer_0239"
FT                   /pseudo
FT   gene            288577..289473
FT                   /db_xref="GeneID:8736680"
FT                   /locus_tag="Acfer_0240"
FT                   /pseudo
FT   gene            289478..291007
FT                   /db_xref="GeneID:8736681"
FT                   /locus_tag="Acfer_0241"
FT   CDS_pept        289478..291007
FT                   /locus_tag="Acfer_0241"
FT                   /gene_family="HOG000237620" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: sfu:Sfum_2378 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="GI:284047623"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="GeneID:8736681"
FT                   /translation="MAGTITLGPKIGLEDFMAVVRFHAPVEFSPEYCERVNRSRALVEK
FT                   WVEEEKVMYGVTTGFGALCTKAISKEETAKLQENIILSHSVSVGKPLPEEAVRGTLLMM
FT                   LQNLGQGYSGVRLEVLEQIRQFLNRGITPWAPGDGSVGYLSPEAHMALVLTGLGKAWYQ
FT                   GQLLEGREALEKAGLAPLALASKEGLALVSGTTSPTALGAIGLYDMLQAARSADVVGAM
FT                   SLEILQGVMNAFDPRVMAVRPHPDQAKAAENVRNLLADSQVIAAAKGSRVQDALSLRCI
FT                   PQLHGAARKTLEDARKTLEIEMNSCCDNPILWPEPGNEEVISACNADSAYVGIAMDGSC
FT                   MAATMLAKMSERRNNRLIDGNLSGCPWFLIQNPGLNSGVMIPQYTQAGLLNQMRILCTP
FT                   AVIDNTPTCGNQEDYVAMGYNAAKKSLAVAEKLEYILAIELLSVYEAQPFVDGRLRRSS
FT                   ASRQVLTEISKEVPEMKEDMYLYPHIEFLRRKILDGSLVRWAETGMGKKLV"
FT                   /product="histidine ammonia-lyase"
FT                   /protein_id="YP_003397962.1"
FT   misc_feature    289499..290932
FT                   /note="tyrosine 2,3-aminomutase; Region: Tyr_2_3_mutase;
FT                   TIGR03832"
FT                   /db_xref="CDD:163544"
FT                   /locus_tag="Acfer_0241"
FT   misc_feature    289508..290800
FT                   /note="Phenylalanine ammonia-lyase (PAL) and histidine
FT                   ammonia-lyase (HAL); Region: PAL-HAL; cd00332"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0241"
FT   misc_feature    order(289637..289645,289649..289651,289655..289657,
FT                   289706..289708,289715..289717,290030..290044,
FT                   290054..290056,290303..290305,290312..290314,
FT                   290402..290404,290444..290446)
FT                   /note="active sites"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0241"
FT   misc_feature    order(289652..289657,289712..289714,289721..289744,
FT                   289805..289807,289889..289894,289922..289924,
FT                   289931..289933,290186..290191,290198..290203,
FT                   290207..290209,290216..290218,290294..290296,
FT                   290300..290308,290312..290317,290324..290329,
FT                   290345..290350,290357..290359,290366..290371,
FT                   290378..290383,290390..290395,290408..290413,
FT                   290420..290422,290435..290437,290441..290461,
FT                   290465..290470,290477..290479,290489..290491,
FT                   290510..290512,290519..290521,290531..290533,
FT                   290543..290545,290552..290554,290561..290563,
FT                   290597..290602,290606..290611,290615..290626,
FT                   290630..290632,290636..290653,290657..290668,
FT                   290699..290719,290726..290728,290744..290749,
FT                   290756..290758,290765..290770)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0241"
FT   gene            291266..292570
FT                   /db_xref="GeneID:8736682"
FT                   /locus_tag="Acfer_0242"
FT   CDS_pept        291266..292570
FT                   /locus_tag="Acfer_0242"
FT                   /gene_family="HOG000279369" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /codon_start="1"
FT                   /product="Na+/H+ antiporter NhaC-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Na+/H+ antiporter NhaC-like; KEGG:
FT                   ctc:CTC02311 transport protein (putative Na+/H+ antiporter,
FT                   hisidine permease)"
FT                   /db_xref="GI:284047624"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="GeneID:8736682"
FT                   /translation="MEILTNPIVVSVIVMSVLCLLKMNVLFAILVAAIVAGSTGGLAID
FT                   KTVSILIGGMGGNSETALSYILLGTLAVAIGRSGVADIAARKITKVVGTKKAAFVFLIA
FT                   FVSCFSQNLIPVHIAFIPILIPPLLVVMNHMKLDRRAVACALTFGLKAPYVSLPVGFGL
FT                   LFMTIIKDQMVANNVQVSISDISSVMWIGGASMLVGLILSTIFYSRDREYKDLPIMGQD
FT                   EKAGETEMNADCWKALAGAVAAFVAQLYFKSLPIGAMCGLLVMLATGAIKWNKMDDMVD
FT                   GGVKMMGFIAFVMLVAAGYANVLRETHSVEALVMATTAVINTKLSGAILMLAVGLLITM
FT                   GIGTSFGTIPVVASIYIPMGLKLGFGIPAIILLIGIAAALGDAGSPASDSTLGPTSGLN
FT                   ADGQHNHIWDTCVPTFIFFDVTLFIGGVIGAMILG"
FT                   /protein_id="YP_003397963.1"
FT   misc_feature    291278..292564
FT                   /note="Predicted permease [General function prediction
FT                   only]; Region: COG2056"
FT                   /db_xref="CDD:32239"
FT                   /locus_tag="Acfer_0242"
FT   misc_feature    <292022..292540
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0242"
FT   gene            292642..294201
FT                   /db_xref="GeneID:8736683"
FT                   /locus_tag="Acfer_0243"
FT   CDS_pept        292642..294201
FT                   /locus_tag="Acfer_0243"
FT                   /gene_family="HOG000237619" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /codon_start="1"
FT                   /EC_number="4.3.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: ctc:CTC02318 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="GI:284047625"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="GeneID:8736683"
FT                   /translation="MLKDVKAIKEVVLNGNDLTLDQLIAVSRYNAKLSFDPDAVDRIKA
FT                   SRALIDDIVNSDRVVYGVTTGFGSLCRVHISKEDCAQLQENLIRTHSCGYGKPLSREVT
FT                   RAAMTIRANALVKGYSGIRLSTLQTLVDMINKGVHPYIPEKGSLGASGDLAPLAHMVLP
FT                   MLGLGDAEYQGTVMPGKEAMERAGIPIIHLEAKEGLALINGTPILTAMGVFALWEGMSL
FT                   LKQSDIAAALSIEAQRGIIDAFDERLHVIRPHRGQLDTAYNLRNLLSGSTYVTHQGQLK
FT                   VQDAYCLRCVPQIHGASKDALGFVKDKVDIEINAATDNPIVLPDGDVISGGNFHGEPMA
FT                   LPFDFLGIGISEIANVSERRLERLINNSLSGFPSFLVKHSGLNSGFMITQYAAAALVSE
FT                   NKVLAHPASVDSIPSCENQEDLVSMGAHAARKAGEIAFNARRVVATEILAACQAIDLRE
FT                   GEGFKLGAGTQAAYDAVRKSNDFIAYDKDIEMFKELEKITNLVQEGGILDAVEDKVDLK
FT                   FF"
FT                   /product="histidine ammonia-lyase"
FT                   /protein_id="YP_003397964.1"
FT   misc_feature    292678..294123
FT                   /note="tyrosine 2,3-aminomutase; Region: Tyr_2_3_mutase;
FT                   TIGR03832"
FT                   /db_xref="CDD:163544"
FT                   /locus_tag="Acfer_0243"
FT   misc_feature    292687..294012
FT                   /note="Phenylalanine ammonia-lyase (PAL) and histidine
FT                   ammonia-lyase (HAL); Region: PAL-HAL; cd00332"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0243"
FT   misc_feature    order(292822..292830,292834..292836,292840..292842,
FT                   292891..292893,292900..292902,293224..293238,
FT                   293248..293250,293497..293499,293506..293508,
FT                   293596..293598,293629..293631)
FT                   /note="active sites"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0243"
FT   misc_feature    order(292837..292842,292897..292899,292906..292929,
FT                   292990..292992,293074..293079,293116..293118,
FT                   293125..293127,293380..293385,293392..293397,
FT                   293401..293403,293410..293412,293488..293490,
FT                   293494..293502,293506..293511,293518..293523,
FT                   293539..293544,293551..293553,293560..293565,
FT                   293572..293577,293584..293589,293602..293610,
FT                   293620..293622,293626..293646,293650..293655,
FT                   293662..293664,293674..293676,293695..293697,
FT                   293704..293706,293716..293718,293728..293730,
FT                   293737..293739,293746..293748,293782..293787,
FT                   293791..293796,293800..293811,293815..293817,
FT                   293821..293838,293842..293853,293884..293904,
FT                   293911..293913,293929..293934,293941..293943,
FT                   293950..293955)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:176460"
FT                   /locus_tag="Acfer_0243"
FT   gene            complement(294305..295720)
FT                   /db_xref="GeneID:8736684"
FT                   /locus_tag="Acfer_0244"
FT   CDS_pept        complement(294305..295720)
FT                   /locus_tag="Acfer_0244"
FT                   /gene_family="HOG000230998" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="FAD linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   fnu:FN1536 (S)-2-hydroxy-acid oxidase chain D"
FT                   /db_xref="GI:284047626"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="GeneID:8736684"
FT                   /translation="MIEYQPITPEVLEALREISGKRVITGEDINPDYTHDDMPIYGIGM
FT                   PEATIDVESTEEIAAIMKLCNKHHIPVTVRGAGTGLAGGATPVQRGLVLCTSRMKQILG
FT                   YDEKNMNVRVQPGVLLDTLSKDALDHGMFYPPDPGEKFATLGGNVSTNAGGMRAVKYGT
FT                   TRDYVQAMTVVLPTGEVIHLGAPVSKTSSGYSLLNLMIGSEGTLGIITELTLKLIAPPK
FT                   CHVTLIVPFAELADGIGAVPAIKHSGLDPQTLEFFEKEILESSEAYMGKSVFPKEVEGQ
FT                   EVGAYLLVTLDSNDQDQLDKLVEEAAEMLLEAGALDVLVADTPMFLEKTWAARSSFLEG
FT                   IEEQFGLLDECDVVVPVSRIPDFVLYIKEIQGDFPFEVKMFGHAGDGNLHIYTCANDMD
FT                   LMEFKKSVEQFMHLLYAKCTELGGQISGEHGIGFGKVQFLAENLGDTTIRLMQGIKEVF
FT                   DPNLILNPNKVCF"
FT                   /protein_id="YP_003397965.1"
FT   misc_feature    complement(295169..295585)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Acfer_0244"
FT   misc_feature    complement(294317..295564)
FT                   /note="glycolate oxidase, subunit GlcD; Region: glcD;
FT                   TIGR00387"
FT                   /db_xref="CDD:129482"
FT                   /locus_tag="Acfer_0244"
FT   gene            295935..297566
FT                   /db_xref="GeneID:8736685"
FT                   /locus_tag="Acfer_0245"
FT   CDS_pept        295935..297566
FT                   /locus_tag="Acfer_0245"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbe:BBR47_47820 hypothetical protein"
FT                   /db_xref="GI:284047627"
FT                   /db_xref="GeneID:8736685"
FT                   /translation="MEQPIRKKIILSLALAGSLCLPVLAAAAPVQDLRTFAQTAGSGKG
FT                   EGPAAQKMAGKPSAVKEARDRKKAETPAAGKDRNRPDQKPDDLHRTREVDFTVQRGQLL
FT                   SEAIGDIDGDGVDEVVDLMGNPAVEKSSFMGDLYLIAREFGPRGQNRVKYYYRPQNLGG
FT                   YNAYLTLADVTGDGYPDVIIASPSGGSGGMVSYRILDVIDGKFQEIFGQEENRGVSMAG
FT                   TYLPGWRARLSFPTLKQDITLDLANEKDAYRNLNVYNEDGSLKESGLRPYIQNLSQLSA
FT                   LDVNGDGVDEVVTIQKVLGVLNADPLGVVRTVWEYRAGGWEPRTVGFQAELYSKPTFSS
FT                   SDKVTGEGGYEIVSLKVPTDNGAVEYPHFQKLDGKLAWKLNHVLESFVRSQLKNVTIGT
FT                   RLNLDYDVKYSGRHYASLMVLGLLTDRDRSQAITRCWNFNMDTGEEVPLKDMIRPWGKF
FT                   WKMVEKETAAGGQALKPEDVTGYYFDGEVLGLLYGDQKEVDLEAEKALPFLTKNRPGEV
FT                   FLTSQSNEGNMKKEAKTEEKNGKTSK"
FT                   /protein_id="YP_003397966.1"
FT   gene            297674..298825
FT                   /db_xref="GeneID:8736686"
FT                   /locus_tag="Acfer_0246"
FT   CDS_pept        297674..298825
FT                   /locus_tag="Acfer_0246"
FT                   /gene_family="HOG000158247" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dma:DMR_04350 efflux system protein"
FT                   /db_xref="GI:284047628"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8736686"
FT                   /translation="MLGKKKVISIGMALLLLVGVAGCGKKTTPAAGDVAVKSMKVIRRD
FT                   TPITYDYTGFVEAANDVQIKSKVTGTVVQKLVNGGDYVEAGQLLYVIDPRNYQNSVLNA
FT                   QANLANAQATLANAQRDASRYQTLYEQGAVSKQTADQYNTQLAQAQAAVDAQSAILASS
FT                   QVDVSDTQIVAPFSGKIDTNPLAEGSFVTANSTVLTTISGSDPMRVRFSVSQADYLDIM
FT                   KGNTNNGTKLQNVTMKLSDGTTYPEKGSVTQVDRGVSDSTGTLTLKAEFQNPNGVLLPG
FT                   MFANLTVVGSLVPNAILVPQRAVTDVMYKHFVYVINDDNTVSMKEVQLGARVGKLWLVK
FT                   SGLDGTETVVVEGVQKLKEGAKVNASPMTEADLDTTDTTTSGK"
FT                   /protein_id="YP_003397967.1"
FT   misc_feature    297779..298762
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="Acfer_0246"
FT   gene            298839..301988
FT                   /db_xref="GeneID:8736687"
FT                   /locus_tag="Acfer_0247"
FT   CDS_pept        298839..301988
FT                   /locus_tag="Acfer_0247"
FT                   /gene_family="HOG000158129" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /codon_start="1"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-
FT                   1 (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   dsa:Desal_3289 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="GI:284047629"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="GeneID:8736687"
FT                   /translation="MAKYFIDHPVFACVIAIIITLVGIISAYNLPIAQYPQISNPRISV
FT                   SANYVGASAEVVEESVAQAIEKQVNGVDNMVDMNSTSDNQGNYTLNVKFELGTDPDMDS
FT                   VKVQNRVAQASASLPSEVSTYGVTTKKQSAETIMYFALTSPNGTYDTLFMKTYGATQFV
FT                   DALKRVKGVSEVSEYGPELSMRVWLDPMKMAQLGVTAADVKNAIASQNVQAPAGSIGAR
FT                   PNEADQEFQYSARVKGRLSTADEFGNIIIKNQNGNLLRVKDVARVEFGPRDDSVTSKLD
FT                   GKNAMNYAISLNTDANALESVAEVKKVLAEAEKSFPPDLKLTIVQDNTEYVRESLKEVV
FT                   VTLVETLVLVVLITWVFLQSWRATLVPTLAIPVSLLGTFGAFIIFDFTINTLTLFALVL
FT                   AIGIVVDDAIVVVEAVEHNVDALGMDPKEATYNAMREVSGAIVATAFVLLAVFLPVAFL
FT                   SGITGVLYKQFALSIVVALSISAVVAMSLSPAVCAMVIKPKDPNGSKGFLGKMFGYFNR
FT                   WLERTTGKYVKNVKRLLRHFKLGLVGLAIVFVLIGMFFKLIPSAYLPDEDQSFAMMTVS
FT                   LPESASTNRTTKVTNDMVAEIRKIPGVKHVLQIVGIDVLSMGRKPNAAILPVKLDDIQN
FT                   RTTDDLSVYSVLKKLNILGNQNPAATGMAFNQAVLPGLSNTGSLSLYIMDTTGHDTAVM
FT                   AKDVQGVLAKIRQRPEVATIYTTFTDNTPALQFDVDRAKAESLNVPVSSVFTALQANLG
FT                   GSEVNDFNLLGKTWKVVIQADPKYRGDVKSFSNLYVASNTGALVPLSALVTSKEIPAAP
FT                   VITRFNGARGAKIAGSPASGYSTGQAISAIEEVLNSQLPSGYTYQWTDQSRDEKAAGSS
FT                   SFLMFGISLVFVYLCLSALYESWSLPLGIIFAVPSAVMGAVGFQYLRGLTSDIYLQIGM
FT                   IVLIGLSAKNAILIVEYAKMRVDDGWAVMPALVDTVTVRLRPILMTAFSTVIGAVPLAW
FT                   ASGAGSGSRTSIGTAIIGGMMASTFLSLFLVPVLFLTIEKVFHPKVPIGSVDDPIPEEQ
FT                   K"
FT                   /protein_id="YP_003397968.1"
FT   misc_feature    298839..301940
FT                   /note="The (Largely Gram-negative Bacterial)
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
FT                   2A0602; TIGR00915"
FT                   /db_xref="CDD:162104"
FT                   /locus_tag="Acfer_0247"
FT   misc_feature    <301458..301865
FT                   /note="Protein export membrane protein; Region: SecD_SecF;
FT                   cl14618"
FT                   /db_xref="CDD:176628"
FT                   /locus_tag="Acfer_0247"
FT   gene            302108..303865
FT                   /db_xref="GeneID:8736688"
FT                   /locus_tag="Acfer_0248"
FT   CDS_pept        302108..303865
FT                   /locus_tag="Acfer_0248"
FT                   /gene_family="HOG000255118" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06472"
FT                   /codon_start="1"
FT                   /product="ABC transporter domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter domain protein; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: pna:Pnap_0638
FT                   ABC transporter"
FT                   /db_xref="GI:284047630"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="GeneID:8736688"
FT                   /translation="MKQTNGTKKLLSQVWRLTRSYWKSEEKKKAYALLVAILLLTLAVV
FT                   AMLVLLNQWNNAFYTALQNYQTEEIFHQLKRFTVLAFLYIILAVYAYYLQQVLVLNWRR
FT                   WLTNRYIDRWLQHQTYYRLEMFGKEMDNPDQRISEDVNLFVTKTLGFFVGIVKALCTLV
FT                   SFVVILWQLSGPFSFALLGRTWHIPGYMVWVAVAYAALGTWLTHRVGHKLVALNFSQQR
FT                   READFRFSMMRMRENAESVAFYQGEGLEGRVFKKRFALLLDNFWKIVLKQKQLVWLSSG
FT                   YSQIAIIFPFVVAIPRFLRRELTLGGLMQVATAFGRVQDSLSYFVDVYASLAEWQAVVD
FT                   RLTGFEEDMARVQAAGSQSHVERLESADGTLRLEPLEVDLPDGRPILKPLDLKLAPGTN
FT                   VLIKGISGSGKSTLLRALAGIWPFARGKVALPPQEDLMFIPQRPYLPLGTLRDAVLYPG
FT                   SREFSDEVLQETLDLCRIGYLGAHLQEEGDWSHVCSIGEQQRLAFARALLYKPRWLFMD
FT                   ESTSALDEETEEALYQVLAAKLPGTTLVSVGHRSTLLRYHQRVLALDKETHTASLESPE
FT                   KWEERLRAQ"
FT                   /protein_id="YP_003397969.1"
FT   misc_feature    302129..303850
FT                   /note="ABC-type uncharacterized transport system, permease
FT                   and ATPase components [General function prediction only];
FT                   Region: COG4178"
FT                   /db_xref="CDD:33918"
FT                   /locus_tag="Acfer_0248"
FT   misc_feature    302135..303004
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:174279"
FT                   /locus_tag="Acfer_0248"
FT   misc_feature    303218..303805
FT                   /note="Peroxisomal ATP-binding cassette transporter (Pat)
FT                   is involved in the import of very long-chain fatty acids
FT                   (VLCFA) into the peroxisome.  The peroxisomal membrane
FT                   forms a permeability barrier for a wide variety of
FT                   metabolites required for and formed...; Region:
FT                   ABCD_peroxisomal_ALDP; cd03223"
FT                   /db_xref="CDD:72982"
FT                   /locus_tag="Acfer_0248"
FT   gene            303888..305240
FT                   /db_xref="GeneID:8736689"
FT                   /locus_tag="Acfer_0249"
FT   CDS_pept        303888..305240
FT                   /locus_tag="Acfer_0249"
FT                   /gene_family="HOG000255106" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /codon_start="1"
FT                   /product="amino acid carrier protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: hmo:HM1_1545 sodium:alanine
FT                   symporter"
FT                   /db_xref="GI:284047631"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="GeneID:8736689"
FT                   /translation="MSIALLNQIDSFVWGPPLLVLLVGTGIFLSFRLGFLQVFRLPRSL
FT                   KLIFSAENQGEGDIDSFKALCTALAATVGTGNIVGVATAIKAGGPGAILWMWIAAFFGM
FT                   ATKYAEGCLAVKYRTVDDKGQISGGPMYYIENGLGKAYRPLAIAFAFFGVLVAYFGIGT
FT                   FAQVNSIVQITQLNAGIPVTYTAVVLTILVAAITLGGLQSIAKTASKVVPAMAVIYMAS
FT                   TIGFLVIFADKVPGAVAEVFYDAFHPTAAVGGFLGASVLFAMRNGVARGVFSNESGLGS
FT                   APIVAAAAKTKWPAEQGLVSMTGTFIDTIIICTMTGLVVVISGLWKTDLNGAALTNAAF
FT                   LQAYPSFGGYMLMVGLVLFAFTTILGWNYYGERCMEYLVGTKGIMPYRIGFIILVGCGA
FT                   FLKLESIWILADIVNGLMAIPNLIALLGLSGVVVAETRKYMEHVKAEKKGV"
FT                   /protein_id="YP_003397970.1"
FT   misc_feature    303900..305228
FT                   /note="Sodium:alanine symporter family; Region:
FT                   Na_Ala_symp; cl00548"
FT                   /db_xref="CDD:163871"
FT                   /locus_tag="Acfer_0249"
FT   gene            305520..306701
FT                   /db_xref="GeneID:8736690"
FT                   /locus_tag="Acfer_0250"
FT   CDS_pept        305520..306701
FT                   /locus_tag="Acfer_0250"
FT                   /gene_family="HOG000224528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /codon_start="1"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   cpy:Cphy_0262 beta-lactamase domain- containing protein"
FT                   /db_xref="GI:284047632"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="GeneID:8736690"
FT                   /translation="MKARTIVSDIYEVGIRDWTLHDFHGFATPRGVTYNSFLIMDEKIC
FT                   LIDGVKAPFAEEQLCNIRTIVDPEKIDYIVVNHVEPDHSGSLPALAKACPNATFLITVQ
FT                   GANELKEHYGDIFKTQIVKKGDTVSLGKRSLAFQPIPMLHWPDSMVTYCPEEQILFSSD
FT                   AFGQHYCCSKLFDDETEVENMLFEAQKYFANILMPYRKLVPNTVKLVRSLPLKMICSCH
FT                   GCIWRSHIDDILNQYESWGKGETVDRVLVVFDTMWGGTAAMARAMIKGIEKQGMRVKLY
FT                   RYESSLKADIVSDLLTAKGILIGSPTQNSGMMPTIGGFLTYLKGLKPTGKKAAAFGTYG
FT                   WAGGAEKDMEAMIRDSGMELLPGYNVKWRPLPKELEAAEQYGFDFAEKVSKGE"
FT                   /protein_id="YP_003397971.1"
FT   misc_feature    305520..306680
FT                   /note="Uncharacterized flavoproteins [Energy production and
FT                   conversion]; Region: FpaA; COG0426"
FT                   /db_xref="CDD:30775"
FT                   /locus_tag="Acfer_0250"
FT   misc_feature    305607..306047
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Acfer_0250"
FT   misc_feature    306264..306677
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Acfer_0250"
FT   gene            306811..307563
FT                   /db_xref="GeneID:8736691"
FT                   /locus_tag="Acfer_0251"
FT   CDS_pept        306811..307563
FT                   /locus_tag="Acfer_0251"
FT                   /gene_family="HOG000218798" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /codon_start="1"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: drm:Dred_0196
FT                   RNA methyltransferase"
FT                   /db_xref="GI:284047633"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="GeneID:8736691"
FT                   /translation="MEEFIVGRNAVREALRSRRPFNKVLVQEGSHGGSLSEILELAQEQ
FT                   KIPVEKVSREVLDRLADGVRHQGVAAQGAPVAFQDLDTVLARVESRGEVPLLLLLDELQ
FT                   DPQNVGALIRTANAAGVHGVLLPQRRSCPLNAVVAKISAGAIEYVPVIQIGNIPQTMKQ
FT                   LKKRGFWIAGADMDGEDQYFDANLTGPMVLVVGAEGKGLGRLVKENCDFIVRIPMLGQV
FT                   SSLNASVAGGILLYDIVRQRILEARKKG"
FT                   /protein_id="YP_003397972.1"
FT   misc_feature    306817..307536
FT                   /note="rRNA methylase, putative, group 3; Region:
FT                   rRNA_methyl_3; TIGR00186"
FT                   /db_xref="CDD:129290"
FT                   /locus_tag="Acfer_0251"
FT   misc_feature    306820..307047
FT                   /note="RNA 2'-O ribose methyltransferase substrate binding;
FT                   Region: SpoU_sub_bind; pfam08032"
FT                   /db_xref="CDD:149230"
FT                   /locus_tag="Acfer_0251"
FT   misc_feature    307132..307518
FT                   /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
FT                   cl00362"
FT                   /db_xref="CDD:174147"
FT                   /locus_tag="Acfer_0251"
FT   gene            307581..308315
FT                   /db_xref="GeneID:8736692"
FT                   /locus_tag="Acfer_0252"
FT   CDS_pept        307581..308315
FT                   /locus_tag="Acfer_0252"
FT                   /gene_family="HOG000219029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   chy:CHY_2333 RNA polymerase factor sigma-70"
FT                   /db_xref="GI:284047634"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:8736692"
FT                   /translation="MQEELRKLYDTLSDEELIQLIQDRDDRQAQDYLLDKYKEFIRLKA
FT                   TRYFLVGAEKEDIIQEGMIGLFKAIRDYRPGKQASFKVFAEICVNRQIISAIKSATRQK
FT                   HRPLNCYVSLDKPVFEEGKERTLLDMLGGSHGVDPENLLVDQEAFNDIERNVSTMLSDL
FT                   EWEALCKYLESKSYQQIAQELHRTTKSIDNALQRVKRKLEKYLASRNHELDLMTLNKGL
FT                   LIMAAKEHLRNHRDKNDRIETI"
FT                   /protein_id="YP_003397973.1"
FT   misc_feature    307605..308210
FT                   /note="RNA polymerase factor sigma-70; Validated; Region:
FT                   PRK08295"
FT                   /db_xref="CDD:169351"
FT                   /locus_tag="Acfer_0252"
FT   misc_feature    307677..307889
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Acfer_0252"
FT   gene            308436..308897
FT                   /db_xref="GeneID:8736693"
FT                   /locus_tag="Acfer_0253"
FT   CDS_pept        308436..308897
FT                   /locus_tag="Acfer_0253"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ace:Acel_0811 hypothetical protein"
FT                   /db_xref="GI:284047635"
FT                   /db_xref="GeneID:8736693"
FT                   /translation="MSQMEEFLKQVEAVQGKEEKVLIVTGKPGSGKSKLLREAAEAKGW
FT                   DYVDTRLLITEEFLKLLPSERKEQAPAMLTEELAGHRGDVILLDRVQTLFVPVFHIDPK
FT                   SVIDALGKAYTVVLAWPGYVNDGLLCYDKFDGTESIRISAADYTVWEVE"
FT                   /protein_id="YP_003397974.1"
FT   misc_feature    <308496..>308753
FT                   /note="Predicted ATP-dependent serine protease
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: Sms; COG1066"
FT                   /db_xref="CDD:31265"
FT                   /locus_tag="Acfer_0253"
FT   misc_feature    308499..>308609
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="Acfer_0253"
FT   misc_feature    order(308511..308513,308526..308537)
FT                   /note="active site"
FT                   /db_xref="CDD:73295"
FT                   /locus_tag="Acfer_0253"
FT   gene            308920..310038
FT                   /db_xref="GeneID:8736694"
FT                   /locus_tag="Acfer_0254"
FT   CDS_pept        308920..310038
FT                   /locus_tag="Acfer_0254"
FT                   /gene_family="HOG000248869" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02483"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.11"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_1386 6-phosphofructokinase; TIGRFAM:
FT                   phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="GI:284047636"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="GeneID:8736694"
FT                   /translation="MQEKKRGTLAVLTGGGDCPGLNAVIRAVVKTALHHGFQIYGISNG
FT                   FHGLICNDMKLMSLSDVSGILPRGGTILGTTNRDNPFHYAAGEDEKGNVIYEDRRDVVV
FT                   RNLKDHGIDCLIVIGGDGSLKIAHDLHRFCDVNVVGVPKTIDNDLPCTERTFGFDTAMA
FT                   MATEALDRLHTTAESHHRVMVLEVMGRYAGWIALHSGIAGGADVILIPEIPYDLDAVIR
FT                   KIHQRQQNGKKFSIITVAEGAKPIGGQLTIARMVKESFEPIRLGGIGEKLAREIEERTG
FT                   IESRCTVLGYLQRGGSPTAYDRVLSTRYGAAAVEACLDEEYNVMVSLQANAIVRVPIAQ
FT                   AASKPHQVPVDSDIVRTGRELGISFGDEKPED"
FT                   /product="phosphofructokinase"
FT                   /protein_id="YP_003397975.1"
FT   misc_feature    308944..310008
FT                   /note="6-phosphofructokinase; Provisional; Region:
FT                   PRK03202"
FT                   /db_xref="CDD:167508"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    308944..309978
FT                   /note="Phosphofructokinase, a key regulatory enzyme in
FT                   glycolysis, catalyzes the phosphorylation of
FT                   fructose-6-phosphate to fructose-1,6-biphosphate. The
FT                   members belong to PFK family that includes ATP- and
FT                   pyrophosphate (PPi)- dependent phosphofructokinases...;
FT                   Region: PFK; cd00363"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    order(308965..308967,309055..309057,309151..309153,
FT                   309280..309288,309292..309297,309349..309351,
FT                   309355..309357,309361..309363,309481..309489,
FT                   309640..309642,309790..309792,309799..309801)
FT                   /note="active site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    order(308965..308967,309055..309057,309151..309153,
FT                   309280..309288,309292..309297)
FT                   /note="ADP/pyrophosphate binding site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    order(308995..308997,309007..309009,309094..309096,
FT                   309109..309111,309118..309120,309379..309381,
FT                   309415..309417,309427..309429,309436..309438,
FT                   309520..309525,309529..309531,309613..309615,
FT                   309826..309831,309841..309843,309862..309864,
FT                   309907..309909)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    order(308995..308997,309007..309009,309094..309099,
FT                   309106..309111,309436..309438,309529..309531,
FT                   309535..309537,309607..309609,309613..309621)
FT                   /note="allosteric effector site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   misc_feature    order(309349..309351,309355..309357,309361..309363,
FT                   309460..309462,309481..309489,309640..309642,
FT                   309772..309774,309790..309792,309799..309801)
FT                   /note="fructose-1,6-bisphosphate binding site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="Acfer_0254"
FT   gene            310188..310991
FT                   /db_xref="GeneID:8736695"
FT                   /locus_tag="Acfer_0255"
FT   CDS_pept        310188..310991
FT                   /locus_tag="Acfer_0255"
FT                   /gene_family="HOG000218356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /codon_start="1"
FT                   /EC_number="3.6.1.27"
FT                   /transl_table="11"
FT                   /note="KEGG: hmo:HM1_1680 undecaprenol diphosphatase,
FT                   putative; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="GI:284047637"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="GeneID:8736695"
FT                   /translation="MSENLIAVLLGIVEGLTEFIPVSSTGHMIIVGHMIGFEGNLAKIF
FT                   DVVIQLGAILAVLVIYKERFARFLTKEGWQMGTGLTGWHIAAGCVPTMAFAYLVHSFIK
FT                   KYLFSPATVAVGLVLGALLMIVAERKIRGHEAELVQDVDHISIRQALYIGFFQFLSLWP
FT                   GFSRSGSTMGGALLVGVNRKAGADFTFIMALPVMVVACLYELLKNISALTGGDLAVLTI
FT                   GFVTAFVVGYFSIVWFMKFLQRSTLTAFGIYRILLALVTVWYFYM"
FT                   /product="undecaprenol kinase"
FT                   /protein_id="YP_003397976.1"
FT   misc_feature    310188..310988
FT                   /note="Bacitracin resistance protein BacA; Region: BacA;
FT                   cl00858"
FT                   /db_xref="CDD:174424"
FT                   /locus_tag="Acfer_0255"
FT   gene            311123..311198
FT                   /note="tRNA-Thr2"
FT                   /db_xref="GeneID:8736696"
FT                   /locus_tag="Acfer_R0011"
FT   tRNA            311123..311198
FT                   /db_xref="GeneID:8736696"
FT                   /locus_tag="Acfer_R0011"
FT                   /product="tRNA-Thr"
FT   gene            311221..311305
FT                   /note="tRNA-Tyr1"
FT                   /db_xref="GeneID:8736697"
FT                   /locus_tag="Acfer_R0012"
FT   tRNA            311221..311305
FT                   /db_xref="GeneID:8736697"
FT                   /locus_tag="Acfer_R0012"
FT                   /product="tRNA-Tyr"
FT   gene            311311..311386
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:8736698"
FT                   /locus_tag="Acfer_R0013"
FT   tRNA            311311..311386
FT                   /db_xref="GeneID:8736698"
FT                   /locus_tag="Acfer_R0013"
FT                   /product="tRNA-Met"
FT   gene            311390..311465
FT                   /note="tRNA-Thr3"
FT                   /db_xref="GeneID:8736699"
FT                   /locus_tag="Acfer_R0014"
FT   tRNA            311390..311465
FT                   /db_xref="GeneID:8736699"
FT                   /locus_tag="Acfer_R0014"
FT                   /product="tRNA-Thr"
FT   gene            311472..311548
FT                   /note="tRNA-Met2"
FT                   /db_xref="GeneID:8736700"
FT                   /locus_tag="Acfer_R0015"
FT   tRNA            311472..311548
FT                   /db_xref="GeneID:8736700"
FT                   /locus_tag="Acfer_R0015"
FT                   /product="tRNA-Met"
FT   gene            311623..312816
FT                   /db_xref="GeneID:8736701"
FT                   /locus_tag="Acfer_0256"
FT   CDS_pept        311623..312816
FT                   /locus_tag="Acfer_0256"
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /codon_start="1"
FT                   /product="translation elongation factor Tu"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor Tu domain protein; KEGG: aac:Aaci_2713
FT                   translation elongation factor Tu"
FT                   /db_xref="GI:284047638"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="GeneID:8736701"
FT                   /translation="MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLSETPGCKAT
FT                   FEAYADIDKAPEERERGITINTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGA
FT                   ILVVSAADGPMPQTREHILLARQVGVPAIVVFLNKSDQVDDPELIELVEMEVRDLLSQY
FT                   GYPGDDIPIVVGSALKALEGDKEQEDNIRKLMKAVDEYIPTPEHDLAKPFLMPIEDVFT
FT                   ITGRGTVATGRVERGVIKVGDTVEIVGLSEEKKQSVATGLEMFRKTLDQAEAGDNIGCL
FT                   LRGIDRTEIERGQVLAKPGTIHPHTKFKGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTD
FT                   VTGVAHLPEGTEMVMPGDNVVMDVELITPIAIEQGLRFAIREGGHTVGAGVVTEIEG"
FT                   /protein_id="YP_003397977.1"
FT   misc_feature    311623..312807
FT                   /note="elongation factor Tu; Reviewed; Region: PRK00049"
FT                   /db_xref="CDD:166747"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311653..312237
FT                   /note="EF-Tu subfamily.  This subfamily includes orthologs
FT                   of translation elongation factor EF-Tu in bacteria,
FT                   mitochondria, and chloroplasts.  It is one of several
FT                   GTP-binding translation factors found in the larger family
FT                   of GTP-binding elongation factors...; Region: EF_Tu;
FT                   cd01884"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311677..311700
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    order(311680..311682,311686..311688,311698..311703,
FT                   311710..311712,311719..311724,311734..311736,
FT                   311824..311829,311881..311886,311953..311958,
FT                   311962..311973,311980..311982,312073..312075,
FT                   312085..312087,312163..312168)
FT                   /note="GEF interaction site; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    order(311686..311703,311767..311769,312034..312039,
FT                   312043..312045,312148..312156)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311794..311826
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311812..311814
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311869..311880
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    311875..311931
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    312034..312045
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    312148..312156
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133284"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    312259..312522
FT                   /note="EFTU_II: Elongation factor Tu domain II. Elongation
FT                   factors Tu (EF-Tu) are three-domain GTPases with an
FT                   essential function in the elongation phase of mRNA
FT                   translation. The GTPase center of EF-Tu is in the
FT                   N-terminal domain (domain I), also known as the...; Region:
FT                   EFTU_II; cd03697"
FT                   /db_xref="CDD:58088"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    312532..312798
FT                   /note="Domain III of elongation factor (EF) Tu. Ef-Tu
FT                   consists of three structural domains, designated I, II and
FT                   III. Domain III adopts a beta barrel structure. Domain III
FT                   is involved in binding to both charged tRNA and binding to
FT                   elongation factor Ts (EF-Ts)...; Region: EFTU_III; cd03707"
FT                   /db_xref="CDD:58073"
FT                   /locus_tag="Acfer_0256"
FT   misc_feature    order(312565..312567,312571..312579,312631..312633,
FT                   312751..312759,312787..312789)
FT                   /note="Antibiotic Binding Site; other site"
FT                   /db_xref="CDD:58073"
FT                   /locus_tag="Acfer_0256"
FT   gene            312955..313116
FT                   /db_xref="GeneID:8736702"
FT                   /locus_tag="Acfer_0257"
FT   CDS_pept        312955..313116
FT                   /locus_tag="Acfer_0257"
FT                   /gene_family="HOG000004838" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L33"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: tpd:Teth39_0359 50S ribosomal protein
FT                   L33"
FT                   /db_xref="GI:284047639"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="GeneID:8736702"
FT                   /translation="MAAGNRVGITLACTECKQRNYQTTKNKKNDTERIEIKKYCKFCKK
FT                   HTMHKETK"
FT                   /protein_id="YP_003397978.1"
FT   misc_feature    312964..313113
FT                   /note="Ribosomal protein L33; Region: Ribosomal_L33;
FT                   cl00383"
FT                   /db_xref="CDD:174162"
FT                   /locus_tag="Acfer_0257"
FT   gene            313128..313352
FT                   /db_xref="GeneID:8736703"
FT                   /locus_tag="Acfer_0258"
FT   CDS_pept        313128..313352
FT                   /locus_tag="Acfer_0258"
FT                   /gene_family="HOG000219149" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /codon_start="1"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: bfa:Bfae_24000
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="GI:284047640"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="GeneID:8736703"
FT                   /translation="MAASQITPDGKSTPGTGGFLREVKTEMKKVTWPTKRELIGYTVTV
FT                   ILSSLFAAFLIWAIDAILSVLFRLVMGVQ"
FT                   /protein_id="YP_003397979.1"
FT   misc_feature    313179..313337
FT                   /note="SecE/Sec61-gamma subunits of protein translocation
FT                   complex; Region: SecE; cl00481"
FT                   /db_xref="CDD:174232"
FT                   /locus_tag="Acfer_0258"
FT   gene            313355..313930
FT                   /db_xref="GeneID:8736704"
FT                   /locus_tag="Acfer_0259"
FT   CDS_pept        313355..313930
FT                   /locus_tag="Acfer_0259"
FT                   /gene_family="HOG000219265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /codon_start="1"
FT                   /product="NusG antitermination factor"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_0305 transcription antiterminator;
FT                   TIGRFAM: transcription termination/antitermination factor
FT                   NusG; PFAM: NGN domain protein; SMART: NGN domain protein"
FT                   /db_xref="GI:284047641"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="GeneID:8736704"
FT                   /translation="MENQKHWYVIHTYSGYENKVKMNLESKIHSLGMEEQIFQVLVPMQ
FT                   NEVDAKDDKQKVVARKVFPGYVLIEMIVDDRTWYAVRNTPGVTGFVGTGTKPIPLSDRE
FT                   VERILGAQPKEGDKAEAAGKAVEEPVVRMECPVGLNDTVRIKAPGFTDMVGTVAEINDE
FT                   QQKIKVMVEMFGRETPIEVKFTQVEAIE"
FT                   /protein_id="YP_003397980.1"
FT   misc_feature    313355..313927
FT                   /note="transcription antitermination protein NusG;
FT                   Validated; Region: nusG; PRK05609"
FT                   /db_xref="CDD:168125"
FT                   /locus_tag="Acfer_0259"
FT   misc_feature    313373..313681
FT                   /note="Transcription termination factor nusG; Region: NusG;
FT                   cl02766"
FT                   /db_xref="CDD:155092"
FT                   /locus_tag="Acfer_0259"
FT   gene            313948..314373
FT                   /db_xref="GeneID:8736705"
FT                   /locus_tag="Acfer_0260"
FT   CDS_pept        313948..314373
FT                   /locus_tag="Acfer_0260"
FT                   /gene_family="HOG000082123" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L11"
FT                   /transl_table="11"
FT                   /note="KEGG: gwc:GWCH70_0098 ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: Ribosomal protein
FT                   L11-like; SMART: ribosomal protein L11"
FT                   /db_xref="GI:284047642"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="GeneID:8736705"
FT                   /translation="MPKKVVKMVKLQVPAGKATPAPPVGPALGQAGINIMAFVKDFNER
FT                   TAKQVGLIIPVEITVFEDRSFTFVTKTPPAAVLLKKACGIEKASGEPNKNKVATIKRDK
FT                   VREIAESKMKDLNAGSVEAAMRMVEGTARSMGITVED"
FT                   /protein_id="YP_003397981.1"
FT   misc_feature    313948..314370
FT                   /note="50S ribosomal protein L11; Validated; Region: rplK;
FT                   PRK00140"
FT                   /db_xref="CDD:166817"
FT                   /locus_tag="Acfer_0260"
FT   misc_feature    313972..314364
FT                   /note="Ribosomal protein L11. Ribosomal protein L11,
FT                   together with proteins L10 and L7/L12, and 23S rRNA, form
FT                   the L7/L12 stalk on the surface of the large subunit of the
FT                   ribosome. The homologous eukaryotic cytoplasmic protein is
FT                   also called 60S ribosomal...; Region: Ribosomal_L11;
FT                   cd00349"
FT                   /db_xref="CDD:100101"
FT                   /locus_tag="Acfer_0260"
FT   misc_feature    order(313975..313977,314035..314037,314167..314175,
FT                   314185..314187,314206..314208,314281..314283,
FT                   314296..314304,314314..314316,314323..314328,
FT                   314335..314340,314344..314352)
FT                   /note="23S rRNA interface; other site"
FT                   /db_xref="CDD:100101"
FT                   /locus_tag="Acfer_0260"
FT   misc_feature    order(313975..313977,314116..314118,314122..314133,
FT                   314143..314145,314149..314154,314284..314289,
FT                   314296..314301)
FT                   /note="L7/L12 interface; other site"
FT                   /db_xref="CDD:100101"
FT                   /locus_tag="Acfer_0260"
FT   misc_feature    order(314023..314025,314035..314037)
FT                   /note="putative thiostrepton binding site; other site"
FT                   /db_xref="CDD:100101"
FT                   /locus_tag="Acfer_0260"
FT   misc_feature    order(314224..314226,314233..314235)
FT                   /note="L25 interface; other site"
FT                   /db_xref="CDD:100101"
FT                   /locus_tag="Acfer_0260"
FT   gene            314428..315129
FT                   /db_xref="GeneID:8736706"
FT                   /locus_tag="Acfer_0261"
FT   CDS_pept        314428..315129
FT                   /locus_tag="Acfer_0261"
FT                   /gene_family="HOG000207015" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: bcg:BCG9842_B5208 50S ribosomal protein
FT                   L1"
FT                   /db_xref="GI:284047643"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="GeneID:8736706"
FT                   /translation="MSKAGKKYTDAAKLIEAGKAYSPKEAVELVKQTSVTKFDSTVEVS
FT                   VRLGVDPKYADQQVRGALVLPNGTGKSKTVLVFARGAKAKEAEAAGADFVGTDEYVEKI
FT                   KGGWTDFDVCVATPDMMGTVGRLGKILGPKGLMPNPKVGTVTMDVTRAVNEIKAGKIEY
FT                   RTDKAGNVQTAIGKVSFDADKLLENYLTLITTLIKVKPSGAKGQYIKSVTLSTTMGPGV
FT                   PVDVLKADSNK"
FT                   /protein_id="YP_003397982.1"
FT   misc_feature    314497..315099
FT                   /note="Ribosomal protein L1.  The L1 protein, located near
FT                   the E-site of the ribosome, forms part of the L1 stalk
FT                   along with 23S rRNA.  In bacteria and archaea, L1 functions
FT                   both as a ribosomal protein that binds rRNA, and as a
FT                   translation repressor that...; Region: Ribosomal_L1;
FT                   cd00403"
FT                   /db_xref="CDD:88601"
FT                   /locus_tag="Acfer_0261"
FT   misc_feature    order(314533..314541,314548..314550,314554..314556,
FT                   314560..314562,314566..314568,314929..314931,
FT                   314935..314937,314941..314943,315079..315084,
FT                   315088..315090)
FT                   /note="mRNA/rRNA interface; other site"
FT                   /db_xref="CDD:88601"
FT                   /locus_tag="Acfer_0261"
FT   gene            315290..315823
FT                   /db_xref="GeneID:8736707"
FT                   /locus_tag="Acfer_0262"
FT   CDS_pept        315290..315823
FT                   /locus_tag="Acfer_0262"
FT                   /gene_family="HOG000004852" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L10"
FT                   /transl_table="11"
FT                   /note="PFAM: ribosomal protein L10; KEGG: mta:Moth_2470 50S
FT                   ribosomal protein L10"
FT                   /db_xref="GI:284047644"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="GeneID:8736707"
FT                   /translation="MHDIRPEKAGKVAELKDLLSSSKGAVLVDYCGLTVAEDTELRSKM
FT                   REAGVKYMVAKNTFIRIAAKEAGIEGLDAYLEHNTAVAFSAEDPVAPAKILNDFSKDHK
FT                   ALEIKAGILDGKVIALDEVKALAELPSREELLAKLVGSMQAPISGLVNVLQGTIRNFVY
FT                   TLEAVRQKKEQESA"
FT                   /protein_id="YP_003397983.1"
FT   misc_feature    315299..315769
FT                   /note="Ribosomal protein L10 family, L10 subfamily;
FT                   composed of bacterial 50S ribosomal protein and eukaryotic
FT                   mitochondrial 39S ribosomal protein, L10. L10 occupies the
FT                   L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
FT                   of L10 interacts with L11...; Region: Ribosomal_L10;
FT                   cd05797"
FT                   /db_xref="CDD:88597"
FT                   /locus_tag="Acfer_0262"
FT   misc_feature    order(315311..315316,315323..315325,315455..315466,
FT                   315473..315475)
FT                   /note="23S rRNA interface; other site"
FT                   /db_xref="CDD:88597"
FT                   /locus_tag="Acfer_0262"
FT   misc_feature    order(315557..315559,315626..315628,315635..315637,
FT                   315683..315685,315692..315697,315704..315709,
FT                   315713..315730,315734..315742,315749..315754,
FT                   315758..315763,315767..315769)
FT                   /note="Interface with L7/L12 ribosomal proteins; other
FT                   site"
FT                   /db_xref="CDD:88597"
FT                   /locus_tag="Acfer_0262"
FT   gene            315898..316263
FT                   /db_xref="GeneID:8736708"
FT                   /locus_tag="Acfer_0263"
FT   CDS_pept        315898..316263
FT                   /locus_tag="Acfer_0263"
FT                   /gene_family="HOG000248813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L7/L12"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: bha:BH0122 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="GI:284047645"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="GeneID:8736708"
FT                   /translation="MDKDQIMEAIENMTVLELADLVKAMEDKFGVSAAAPVAVAAAPAA
FT                   GAAAAEKTEFDVVLKDAGASKINVIKVVRELTGLGLKEAKAAVDAAPNAIKEHVAKADA
FT                   EAMKAKLEEAGATVELK"
FT                   /protein_id="YP_003397984.1"
FT   misc_feature    315898..316257
FT                   /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
FT                   refers to the large ribosomal subunit proteins L7 and L12,
FT                   which are identical except that L7 is acetylated at the N
FT                   terminus. It is a component of the L7/L12 stalk, which is
FT                   located at the surface of...; Region: Ribosomal_L7_L12;
FT                   cd00387"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(315898..315900,315937..315945,315952..315957,
FT                   315964..315966,315973..315975,316018..316020,
FT                   316027..316032,316036..316044,316054..316059,
FT                   316120..316122,316126..316131,316135..316137,
FT                   316141..316146,316186..316191,316195..316197,
FT                   316204..316206)
FT                   /note="core dimer interface; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(315907..315909,315916..315918,315928..315930,
FT                   315967..315969,315982..315984)
FT                   /note="peripheral dimer interface; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(315949..315951,315958..315963,315973..315975,
FT                   315982..315984)
FT                   /note="L10 interface; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(316093..316098,316105..316110,316117..316119,
FT                   316138..316143,316150..316152)
FT                   /note="L11 interface; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(316096..316098,316108..316110,316117..316119,
FT                   316138..316143,316150..316152)
FT                   /note="putative EF-Tu interaction site; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   misc_feature    order(316096..316098,316105..316110,316117..316119)
FT                   /note="putative EF-G interaction site; other site"
FT                   /db_xref="CDD:100102"
FT                   /locus_tag="Acfer_0263"
FT   gene            316649..317674
FT                   /db_xref="GeneID:8736709"
FT                   /locus_tag="Acfer_0264"
FT   CDS_pept        316649..317674
FT                   /locus_tag="Acfer_0264"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; NIL domain; SMART:
FT                   AAA ATPase; KEGG: yen:YE4181 ABC transporter"
FT                   /db_xref="GI:284047646"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="GeneID:8736709"
FT                   /translation="MIKFQDISKTFKIGSGAVQALQHVDLEVEKGDIFGVIGFSGAGKS
FT                   TLLRMVNALETPTEGHVEIEGQIIDQLSHNELRKVRKKIGMIFQQFNLLDSRTVYENVA
FT                   IPLRLNHTEPVQLDRTVKTLLQFVGLEDKAGSYPIQLSGGQKQRVGIARALATNPSILL
FT                   CDEATSALDPETTEQILQLLRRINRELKITILFVTHQIQVIQQLCNKVAVMEHGRVVEQ
FT                   GSVLEVFSNPQQEITRKFVRTVIPDTIPESIQEDLKKDPRPFRLLKLRFLGRQASEGDI
FT                   SVLSEEIGLKTNIVFATVTELQQTALGIFILQCLDEGDKLARSEEYLTRKGILWKEVSL
FT                   S"
FT                   /protein_id="YP_003397985.1"
FT   misc_feature    316649..317665
FT                   /note="ABC-type metal ion transport system, ATPase
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   AbcC; COG1135"
FT                   /db_xref="CDD:31330"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    316649..317347
FT                   /note="MetN (also known as YusC) is an ABC-type transporter
FT                   encoded by metN of the metNPQ operon in Bacillus subtilis
FT                   that is involved in methionine transport.  Other members of
FT                   this system include the MetP permease and  the MetQ
FT                   substrate binding protein...; Region:
FT                   ABC_MetN_methionine_transporter; cd03258"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    316760..316783
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    order(316769..316774,316778..316786,316913..316915,
FT                   317141..317146,317243..317245)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    316904..316915
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    317069..317098
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    317129..317146
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    317153..317164
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    317231..317251
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73017"
FT                   /locus_tag="Acfer_0264"
FT   misc_feature    317465..317662
FT                   /note="NIL domain; Region: NIL; pfam09383"
FT                   /db_xref="CDD:150152"
FT                   /locus_tag="Acfer_0264"
FT   gene            317671..318336
FT                   /db_xref="GeneID:8736710"
FT                   /locus_tag="Acfer_0265"
FT   CDS_pept        317671..318336
FT                   /locus_tag="Acfer_0265"
FT                   /gene_family="HOG000222815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yen:YE4182 ABC transporter
FT                   permease"
FT                   /db_xref="GI:284047647"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8736710"
FT                   /translation="MIEKLGVPASQLILSAEQTLYMVFVSLVVGSILAIVLAMILVLTN
FT                   DNGILKNRPIYLVLNTIINIIRSVPFIILMVFIMPLTKTIVGTRIGTTAALIPLIVFIT
FT                   PYLTRLFENSILDVNRGIVEAAQAMGASYFEIVWYFLLPEAKGSLILSITTGTIGLIGA
FT                   TAMAGAIGAGGVGDLALTYGYERMNTPLMLFTVVVLIIFVQIIQTVGNHFAYKTRNHG"
FT                   /protein_id="YP_003397986.1"
FT   misc_feature    317818..>318108
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0265"
FT   misc_feature    order(317863..317895,317896..317898)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0265"
FT   misc_feature    order(318031..318069,318085..318090,318100..318102)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0265"
FT   gene            318358..319209
FT                   /db_xref="GeneID:8736711"
FT                   /locus_tag="Acfer_0266"
FT   CDS_pept        318358..319209
FT                   /locus_tag="Acfer_0266"
FT                   /gene_family="HOG000222927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /codon_start="1"
FT                   /product="NLPA lipoprotein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: bld:BLi03178
FT                   hypothetical protein"
FT                   /db_xref="GI:284047648"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="GeneID:8736711"
FT                   /translation="MNTGKLKKWLVIGLAAVMTTALVAGCGSDSGKSTDKGASTKKELK
FT                   YSKSQGPYSDLFEKGVKPILEKKGYKFAGKDMSDLLQADIALNEGEVDFNVEQHTAYME
FT                   NFNKKQGGHLAAITPIPTVPAGIFAGSKTSLDQVADGDTVAVPNDASNTARAYALLQKA
FT                   GWIKLDPKKDLSTVTQQDIIENPHHLKFTEMKSLNIPAVRNDFSYIVITGAIIYNAKID
FT                   PATALMKEDILLHLMLQLVVQDKNKDAQWAKDIADAYKSAEFQEYMKKNNKGLWFDPNA
FT                   KK"
FT                   /protein_id="YP_003397987.1"
FT   misc_feature    318373..319179
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Acfer_0266"
FT   gene            319275..320450
FT                   /db_xref="GeneID:8736712"
FT                   /locus_tag="Acfer_0267"
FT   CDS_pept        319275..320450
FT                   /locus_tag="Acfer_0267"
FT                   /gene_family="HOG000241404" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.14"
FT                   /transl_table="11"
FT                   /note="KEGG: cdf:CD1086 putative peptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:284047649"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:8736712"
FT                   /translation="MDVKERVAALQPELVRLRRHFHEKPERSWEEFQTQKAIESYLDAL
FT                   GIPYVESCKSGVIATLKGPHASDRIIGIRADIDALPITELGDPAYKSQNPGTMHACGHD
FT                   THITILLGAAKVLAAMKDQLTVTVRFLFQPAEEEIANSGAAYMKEEPLVKECDRLIALH
FT                   IWSKIPAGWASLRYGPVMSAADTFDVTVEGRGGHGALPHQTVDPIVAGAEFVTALQTVV
FT                   SREVNPLEPAVLSITQFQGGTTSNVIPGEAHLAGTARTFSKELRDAYPGILERVAQGVS
FT                   TATRAKLRTVYHFGPPPMINDKACVDTGRKACAKVFAPDKLVDWELQMGGEDFAKYSNP
FT                   KCLLLLGGGFADEDRRYPQHSPYFDIDEKALGLGVEYFVQYVLEWEKELKK"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_003397988.1"
FT   misc_feature    319296..320435
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Acfer_0267"
FT   misc_feature    319299..320396
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0267"
FT   gene            320523..320981
FT                   /db_xref="GeneID:8736713"
FT                   /locus_tag="Acfer_0268"
FT   CDS_pept        320523..320981
FT                   /locus_tag="Acfer_0268"
FT                   /gene_family="HOG000021336" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04284"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF441"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF441; KEGG:
FT                   lba:Lebu_0431 protein of unknown function DUF441"
FT                   /db_xref="GI:284047650"
FT                   /db_xref="InterPro:IPR007382"
FT                   /db_xref="GeneID:8736713"
FT                   /translation="MMQPYLILGFMIVLGYLAHNLTVSYAAGLLVLMKLVLPEEKLMYF
FT                   SSHGVNWGIILLMAALMVPIATGKIGLSETLGVFRNPMGIASLVIGALVALLGRWGVDL
FT                   MGEDPEVVAAMLIGTIIGVFLFKGVPVGPMIASGLLYCLMKLMHLFFH"
FT                   /protein_id="YP_003397989.1"
FT   misc_feature    320538..320954
FT                   /note="Protein of unknown function (DUF441); Region:
FT                   DUF441; cl01041"
FT                   /db_xref="CDD:154163"
FT                   /locus_tag="Acfer_0268"
FT   gene            complement(321119..321541)
FT                   /db_xref="GeneID:8736714"
FT                   /locus_tag="Acfer_0269"
FT   CDS_pept        complement(321119..321541)
FT                   /locus_tag="Acfer_0269"
FT                   /gene_family="HOG000030540" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01753"
FT                   /codon_start="1"
FT                   /product="flavodoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: eel:EUBELI_00571 hypothetical protein"
FT                   /db_xref="GI:284047651"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="GeneID:8736714"
FT                   /translation="MSKIAVVFWSGTGNTEAMAKAVEEGAKGKGAEVVEYGASAFSAGE
FT                   VSKYDAIAFGCPAMGAEVLEEGEFQPMWDEVKGSLKGKKIALFGSYGWGSGEWMDNWKA
FT                   EAEGEGAVLAADPVMANNAPDDEALAQCRALGEALA"
FT                   /protein_id="YP_003397990.1"
FT   misc_feature    complement(321122..321541)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Acfer_0269"
FT   gene            complement(321589..322152)
FT                   /db_xref="GeneID:8736715"
FT                   /locus_tag="Acfer_0270"
FT   CDS_pept        complement(321589..322152)
FT                   /locus_tag="Acfer_0270"
FT                   /gene_family="HOG000039883" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_00570"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00570 hypothetical protein"
FT                   /db_xref="GI:284047652"
FT                   /db_xref="GeneID:8736715"
FT                   /translation="MTITLETELVRQCAPTLTGLKAASLFRFVFRPEDSPFAQIAEIRR
FT                   SLEPKEIRLEVLSYDCIRQSALLYVYRPHRLSILLQDPESRSFLKRQGYGSTTCQEILD
FT                   QMALRLARRDPFPHEIGILLDYPLEDVKAYMASPRDKGVCSGCWKAYGNRERAACYFAK
FT                   CQKCTRIYWRCYCAGTPLSRLAVA"
FT                   /protein_id="YP_003397991.1"
FT   gene            322395..323924
FT                   /db_xref="GeneID:8736716"
FT                   /locus_tag="Acfer_0271"
FT   CDS_pept        322395..323924
FT                   /locus_tag="Acfer_0271"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /codon_start="1"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: dat:HRM2_48490 outer membrane protein"
FT                   /db_xref="GI:284047653"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:8736716"
FT                   /translation="MKWWKPVVVGLSLTLAPGLMQPAQAGKKNPQPKAEKMPSWTELAQ
FT                   KHPAAYDRTTPETSLTEQQLADWWKTFQDPKLDALIDLSLKNNRDLQAAQARVEEARAQ
FT                   LGISKGEALPWLNLGGTYGRYEAPRGINDKISGMSPYPGVINPPDRNSSVAGLGIDASW
FT                   EPDFFGRLKARKQSAAHNLAAQHAALYSTWVTLSAETALNYVSLRTLQQDLDLLERHAA
FT                   LEGEKADLLQTNYQAGLISAYPLEAMRTQEQNTRAEIPRTRQAIQETLTRLSILTGTEP
FT                   GQLNDFLDPEDLPEIDPELYHAIPANLMRQRPDIRAAEERLEAQIARTKEARAELKPRF
FT                   TLGGFLGLITLGGGNLFGSGARSFAIAPSFTFPLFHGGQLRQNVKLQDARAREYQAQYE
FT                   NTVLKAAGEVQDAMTGIVQEKERKDKLSAGVDNAQGAFDLAENRFQAGLSDYQPVLDSE
FT                   RTLLTMKRQENRSRGQELADLIHLYKALGGGWKPLSDGEQAEISRAEGKGK"
FT                   /protein_id="YP_003397992.1"
FT   misc_feature    322515..323861
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="Acfer_0271"
FT   misc_feature    322623..323228
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Acfer_0271"
FT   misc_feature    323319..323855
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="Acfer_0271"
FT   gene            323921..324961
FT                   /db_xref="GeneID:8736717"
FT                   /locus_tag="Acfer_0272"
FT   CDS_pept        323921..324961
FT                   /locus_tag="Acfer_0272"
FT                   /gene_family="HOG000014875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /codon_start="1"
FT                   /product="secretion protein HlyD family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bbr:BB2383 HlyD family secretion protein"
FT                   /db_xref="GI:284047654"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8736717"
FT                   /translation="MMAFWNTLLQDKKKLAAAVAVVVLACGLGGYGYQQYQAKKAARQL
FT                   TLYGNVDVREVAVAFRESDRIAEELVEEGDKVKKGQVLARLDTEELKIKKSKLQAQIAA
FT                   QQSVVDKLHNGTRAEDLEAARAKADEAAAQADQARQDLARVENAFASSQGKSVSKQDRD
FT                   AARTKVDVTAAQAEAARQEYEKAQAGPRDEDVAGGEAQLKALQEDAKHIDYLLSQAELK
FT                   APADGVIRSRLLEVGDMASPQKPVFKLSLNDKKWVRVYVSEKDLGRIYEGMKARVYTDS
FT                   HPKNPIEGQIGYISSTAEFTPKTVQTTELRTSLLYEVRVYVTDPDNVLRMGMPATVKID
FT                   TEQSHD"
FT                   /protein_id="YP_003397993.1"
FT   misc_feature    324047..324958
FT                   /note="hypothetical protein; Provisional; Region: PRK03598"
FT                   /db_xref="CDD:167554"
FT                   /locus_tag="Acfer_0272"
FT   gene            324954..326702
FT                   /db_xref="GeneID:8736718"
FT                   /locus_tag="Acfer_0273"
FT   CDS_pept        324954..326702
FT                   /locus_tag="Acfer_0273"
FT                   /gene_family="HOG000014887" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pag:PLES_25911 ATP-binding protein"
FT                   /db_xref="GI:284047655"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736718"
FT                   /translation="MTEWVVQAEKLDKLFDDKQGKAHALKQVDFLAKKGKMTALIGPDG
FT                   AGKTTTMRLICGLMDPTGGSLKVLGLDSVKDASEIQSRISYMPQKFGLYEDLTIQENMD
FT                   LYADLHGVPDDVRKTRFAKLLDMTGLAPFTGRLAGKLSGGMKQKLGLACTLVRSPDLLL
FT                   LDEPTVGVDPLSRKDLWIIINQMVQEEHLSVIVCTAYMNEAAMCDEVYVLNEGNILFNG
FT                   TPEGLSQVAAGKCFEVNPPAGLPYRVLQGSLLDDKEEIIDAVPQSGTVRYIAAHPGTAL
FT                   PALERWNLVPKAVPPRVEDGFMILLHQAANLEEKRIPLAPLDKVPSDPTQNDMSITVRD
FT                   LVKKFGDFTAVSHTSFEVHKGEVFGLLGPNGAGKTTTFRMLCGLLPATSGVLSVAGENL
FT                   RTARTQARAKIGYVSQKFSLYSKLSVLENLQFYGGIYGLPPRKLKERIQAVLEEFQLTG
FT                   QEAHNAGDLPGGYKQRLSMACALLQEPEILFLDEPTSGIDPLARRMFWRQITDLACRGV
FT                   TIIITTHFMEEAEYCDRIMIQDRGKCLVLGSPTRIRADLGMPDANMDDVFIEIVHRGRG
FT                   EEAAGS"
FT                   /protein_id="YP_003397994.1"
FT   misc_feature    324954..326615
FT                   /note="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase [General function
FT                   prediction only]; Region: COG1123"
FT                   /db_xref="CDD:31320"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    324969..325634
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325077..325100
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    order(325086..325091,325095..325103,325218..325220,
FT                   325446..325451,325548..325550)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325209..325220
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325374..325403
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325434..325451
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325458..325469
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325536..325556
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    325959..326612
FT                   /note="The ABCA subfamily mediates the transport of a
FT                   variety of lipid compounds.  Mutations of members of ABCA
FT                   subfamily are associated with human genetic diseases, such
FT                   as, familial high-density lipoprotein (HDL) deficiency,
FT                   neonatal surfactant deficiency...; Region: ABC_subfamily_A;
FT                   cd03263"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326055..326078
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    order(326064..326069,326073..326081,326196..326198,
FT                   326424..326429,326523..326525)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326187..326198
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326352..326381
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326412..326429
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326436..326447
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   misc_feature    326511..326531
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73022"
FT                   /locus_tag="Acfer_0273"
FT   gene            326699..327808
FT                   /db_xref="GeneID:8736719"
FT                   /locus_tag="Acfer_0274"
FT   CDS_pept        326699..327808
FT                   /locus_tag="Acfer_0274"
FT                   /gene_family="HOG000270977" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: nmu:Nmul_A1420
FT                   hypothetical protein"
FT                   /db_xref="GI:284047656"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="GeneID:8736719"
FT                   /translation="MKEKLRRIRALTVKEFREVLRDNSSLAMGLLLPLILILVIGYGIS
FT                   LDVKHAPIGVVLEDASPEAQQVVDFVDGSEYFQPTYLTSMHQAVRALEQRKIDAILRVP
FT                   PDFTRQLHQGDGRLQLLLYGTDTTTAMTIQSYVETAAAQWSARQMASRGVGGVDLETRL
FT                   WFNDAHESTWYFLPGLILMIVTLVGVLLTAGVMAREYERGTFESLFVTPVKKGEIIVAK
FT                   MIPYFCIAMLGVFLCLILSRFLFQVPLVGSLALVIFMSILYLLTALGMGMLISVVTKAQ
FT                   FMAIQIALLVSFLPSIMLSGFLFDLRATPQWVQWIGEFLPFKHYLVVLKTLLLAGNLWP
FT                   VILPQTGFLIFFMVLFVGLALKTIRKKVE"
FT                   /protein_id="YP_003397995.1"
FT   misc_feature    326966..327805
FT                   /note="ABC-type multidrug transport system, permease
FT                   component [Defense mechanisms]; Region: COG0842"
FT                   /db_xref="CDD:31184"
FT                   /locus_tag="Acfer_0274"
FT   misc_feature    327185..327676
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Acfer_0274"
FT   gene            327809..328924
FT                   /db_xref="GeneID:8736720"
FT                   /locus_tag="Acfer_0275"
FT   CDS_pept        327809..328924
FT                   /locus_tag="Acfer_0275"
FT                   /gene_family="HOG000270979" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: vap:Vapar_1738
FT                   ABC-2 type transporter"
FT                   /db_xref="GI:284047657"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="GeneID:8736720"
FT                   /translation="MSPWQLFCQQVRFICRKELLAIWKDKAFRYVLVIPTLVLGVVFGY
FT                   TATFNVENVTYAVLDQSHSEASTSLLATLDGTRFFQRVADLQNTAQIQEPIDQENVMVV
FT                   LSIPEDFEEKLARGEKAPLQVITDGRNTMTASLASAYTSRVVQQWLEARTGRHPPLSVE
FT                   ARTWFNPNQLTLWYFAPGILGLMSFAQVILLAGMSVAREREEGTFEQLLVTPAPPLVLL
FT                   IGKAFPPVLVGMMQGTLLLLLDLFWFQVPFEGSYLTLYLVLFIYFLSSTGIGLSISSVC
FT                   SSMQQVQVYTYVYLIPNALLSGVATPVRNMPQFLQLLTYGDPLRFALDAIRRIYFEGAG
FT                   LAAIAPDLLPMTIVAVLTLWLAAVLFRKNLG"
FT                   /protein_id="YP_003397996.1"
FT   misc_feature    <328337..328867
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="Acfer_0275"
FT   gene            329087..330202
FT                   /db_xref="GeneID:8736721"
FT                   /locus_tag="Acfer_0276"
FT   CDS_pept        329087..330202
FT                   /locus_tag="Acfer_0276"
FT                   /gene_family="HOG000225291" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /codon_start="1"
FT                   /product="peptidase dimerization domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: sth:STH1479 putative peptidase"
FT                   /db_xref="GI:284047658"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:8736721"
FT                   /translation="MNDVLRKMVEDYIHNRMPEYIQTLYDVITIPSPTGEEGEKARWIL
FT                   DQLKAMGAEGACQDEAGNVIFPYCIEGVEKFPLYTAHMDTVFAGVEKIMPEIDGHTLKA
FT                   PSCGDNSSDVAALLFLIRMMLTLKLRTPAVFAFNVGEEGLGNLKGSRALTDAFGDRLSY
FT                   FMAVDGNSDRFVNLAVGSRRYAVHVVTPGGHSYAAFGAANAISEAAGIIRDFYDLQVPE
FT                   DPKTTYNVGTIQGGTTINSIAAEVEFTVDMRSVSHTELEKLDAAFQVILQAHQRADVKI
FT                   ETLLLGERPCSEGVQHHEIHDRITAIRKRAGLQTTFSASSTDANIPLSRNIPAIAFGVS
FT                   RGKGAHTLQEELDMTSLEPGLKQLAAFIWNL"
FT                   /protein_id="YP_003397997.1"
FT   misc_feature    329105..330199
FT                   /note="Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases [Amino acid transport
FT                   and metabolism]; Region: ArgE; COG0624"
FT                   /db_xref="CDD:30969"
FT                   /locus_tag="Acfer_0276"
FT   misc_feature    329138..330190
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0276"
FT   gene            330380..331156
FT                   /db_xref="GeneID:8736722"
FT                   /locus_tag="Acfer_0277"
FT   CDS_pept        330380..331156
FT                   /locus_tag="Acfer_0277"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sto:ST1078 hypothetical protein"
FT                   /db_xref="GI:284047659"
FT                   /db_xref="GeneID:8736722"
FT                   /translation="MSKKCKQCGCELADDALFCVQCGAKQDPVVKCPKCGHVNPAGNDF
FT                   CTECGTRLKEAEPAEKKSEGEKPAAEPQEATAENTKVVVAEPVTGGQGGGGNQGFQGFQ
FT                   MPPVPPEGNGKKKKILAIIAAVVVILGLFFAFGGSSKPIQVKSGEMVDDYIRDQSSGDK
FT                   KYKDKTVQLSGKVKWKGQFNNSQNYSITLESRNNGGKTYQILVDVPAKRASIVNSLKTG
FT                   DFVNVKGKCVGIVKQKNPTLISVQIKSTKINDQDAD"
FT                   /protein_id="YP_003397998.1"
FT   misc_feature    <330455..330538
FT                   /note="acetolactate synthase 3 catalytic subunit; Reviewed;
FT                   Region: PRK07418"
FT                   /db_xref="CDD:168947"
FT                   /locus_tag="Acfer_0277"
FT   gene            331176..331766
FT                   /db_xref="GeneID:8736723"
FT                   /locus_tag="Acfer_0278"
FT   CDS_pept        331176..331766
FT                   /locus_tag="Acfer_0278"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /codon_start="1"
FT                   /product="SH3 type 3 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SH3 type 3 domain protein; SMART: SH3 domain
FT                   protein; KEGG: shi:Shel_22480 hypothetical protein"
FT                   /db_xref="GI:284047660"
FT                   /db_xref="InterPro:IPR001899"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR013247"
FT                   /db_xref="GeneID:8736723"
FT                   /translation="MARYCAHCGNQLTEGEKFCPVCGSPVEQPAAPARPEGGKNTAPQP
FT                   GPRSQQPAGSFQPKGDLPHQSGRGKWIALVIGLMLAAVGAGIFFARQKDDKSAADTKPP
FT                   VTQEEKKQEAPRKPANGAAQGEKNQKDANQSYGKITGTDVRLRAGAGTHTDIVDYFDEG
FT                   EKVEITGRKNNWYQVKRANGQTGYVSTQFCRRL"
FT                   /protein_id="YP_003397999.1"
FT   misc_feature    331182..>331472
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG4640"
FT                   /db_xref="CDD:34259"
FT                   /locus_tag="Acfer_0278"
FT   misc_feature    331599..331751
FT                   /note="Bacterial SH3 domain; Region: SH3_3; cl02551"
FT                   /db_xref="CDD:141512"
FT                   /locus_tag="Acfer_0278"
FT   gene            331791..332408
FT                   /db_xref="GeneID:8736724"
FT                   /locus_tag="Acfer_0279"
FT   CDS_pept        331791..332408
FT                   /locus_tag="Acfer_0279"
FT                   /gene_family="HOG000159798" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /codon_start="1"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bfs:BF0621 putative ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="GI:284047661"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="GeneID:8736724"
FT                   /translation="MGKYHDAYQKRRWKGPAWGVFFLLVLLLAVGSGIKGCRNGQKAEP
FT                   AAAPPAETAVTGDVRQTPEPHDYALLIKKGEFTLYLLDHGEPVAKWPVALGKNPGQKQV
FT                   SGDMKTPEGTFPVDEIIDASSWSHDFHDGKGVIQHAYGPWFISLDTRNLSKGKWDGIGI
FT                   HGTHDPASIGTRASEGCIRLENGNLQKLKPYVKVGMKVTVEE"
FT                   /protein_id="YP_003398000.1"
FT   misc_feature    331989..332399
FT                   /note="L,D-transpeptidase catalytic domain; Region: YkuD;
FT                   pfam03734"
FT                   /db_xref="CDD:146395"
FT                   /locus_tag="Acfer_0279"
FT   gene            332451..332741
FT                   /db_xref="GeneID:8736725"
FT                   /locus_tag="Acfer_0280"
FT   CDS_pept        332451..332741
FT                   /locus_tag="Acfer_0280"
FT                   /gene_family="HOG000167986" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aac:Aaci_2326 GCN5-related N- acetyltransferase"
FT                   /db_xref="GI:284047662"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:8736725"
FT                   /translation="METIRLVKEPEKFRAALYDGAEEIGQCTYVNARPGVWTLDHTIVD
FT                   PRYGGRGLAGKLVRAVAEMAREAGVKIIPQCSYARVQFDRKPEYADVYEKE"
FT                   /protein_id="YP_003398001.1"
FT   misc_feature    332451..332729
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Acfer_0280"
FT   gene            333218..334681
FT                   /db_xref="GeneID:8736726"
FT                   /locus_tag="Acfer_0281"
FT   CDS_pept        333218..334681
FT                   /locus_tag="Acfer_0281"
FT                   /gene_family="HOG000025142" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /codon_start="1"
FT                   /EC_number="4.1.3.27"
FT                   /transl_table="11"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: cce:Ccel_3213
FT                   anthranilate synthase component I"
FT                   /db_xref="GI:284047663"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="GeneID:8736726"
FT                   /translation="MKQQSLEEIKALAQGYAAVPVVREILADTATPIGLVSLVRKESSR
FT                   YFLLESLEQNDQAGRYSFIGFDPIARIRAKDRNTQVEFAGSRIPVDPRQPLEALRSILK
FT                   AYRVPTIPGLPPFTGGFVGYFSYDFFQYCEPSLHFDPAKATEFPDFDLMLFDKVIVFDR
FT                   VLQKMYLIVNIKTDDLEGNYAKAQKNLDAMEALVRQPVAPPAFTPARLGEITSNQERKT
FT                   YGENMEKIKEHIRQGDIFQAVYSQRFSASYDQDLFNMYRILRTTNPSQYMVLLKNDKVE
FT                   IAGSSPETLIKVQGREITSMPIAGTRRRGRTEEEDNALERDMQTDPKELAEHNMLVDLA
FT                   RNDVGKVAEFGSVKVHDHLLVKKFSHVMHMTTRVTGTLKEDRDAIDALCAAFPAGTLSG
FT                   APKVRACEILDGLEPERRGPYGGGMGYLDFAGNMDICIVIRTAVKYGDRVSFQTGSGIV
FT                   ADSKVEDEFMETINKAAAVRQALEVTTEA"
FT                   /product="Anthranilate synthase"
FT                   /protein_id="YP_003398002.1"
FT   misc_feature    333296..334663
FT                   /note="anthranilate synthase component I,
FT                   non-proteobacterial lineages; Region: trpE_most; TIGR00564"
FT                   /db_xref="CDD:161932"
FT                   /locus_tag="Acfer_0281"
FT   misc_feature    333299..333727
FT                   /note="Anthranilate synthase component I, N terminal
FT                   region; Region: Anth_synt_I_N; pfam04715"
FT                   /db_xref="CDD:147064"
FT                   /locus_tag="Acfer_0281"
FT   misc_feature    333875..334591
FT                   /note="chorismate binding enzyme; Region: Chorismate_bind;
FT                   cl10555"
FT                   /db_xref="CDD:176612"
FT                   /locus_tag="Acfer_0281"
FT   gene            334683..335261
FT                   /db_xref="GeneID:8736727"
FT                   /locus_tag="Acfer_0282"
FT   CDS_pept        334683..335261
FT                   /locus_tag="Acfer_0282"
FT                   /gene_family="HOG000025029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   ere:EUBREC_2979 anthranilate/para- aminobenzoate synthase
FT                   component II, TrpG"
FT                   /db_xref="GI:284047664"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="GeneID:8736727"
FT                   /translation="MELIIDNYDSFTYNLYQYMGTLNPDIQVIRNDAITVEGIRKLQPD
FT                   HLILSPGPGRPCDAGVCEPALRELKGEFPILGVCLGHQAIGEVFGGTVTYARQLMHGKR
FT                   STVILDRTSPLFRGLPEQILVGRYHSLAIDPDTMPEVLKATATTADGEVMAVEHREYPI
FT                   YGLQFHPESILTPEGMTIIRNFLDLRISK"
FT                   /protein_id="YP_003398003.1"
FT   misc_feature    334683..335249
FT                   /note="para-aminobenzoate synthase component II;
FT                   Provisional; Region: PRK08857"
FT                   /db_xref="CDD:169573"
FT                   /locus_tag="Acfer_0282"
FT   misc_feature    334689..335240
FT                   /note="Type 1 glutamine amidotransferase (GATase1) domain
FT                   found in Anthranilate synthase; Region:
FT                   GATase1_Anthranilate_Synthase; cd01743"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Acfer_0282"
FT   misc_feature    order(334833..334838,334842..334844,334917..334922,
FT                   334929..334931,335064..335075)
FT                   /note="glutamine binding; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Acfer_0282"
FT   misc_feature    order(334917..334919,335187..335189,335193..335195)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Acfer_0282"
FT   gene            335283..336305
FT                   /db_xref="GeneID:8736728"
FT                   /locus_tag="Acfer_0283"
FT   CDS_pept        335283..336305
FT                   /locus_tag="Acfer_0283"
FT                   /gene_family="HOG000230451" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /codon_start="1"
FT                   /EC_number="2.4.2.18"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_2978 anthranilate
FT                   phosphoribosyltransferase, TrpD; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="GI:284047665"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="GeneID:8736728"
FT                   /translation="MIKEAIIKLVNKGDLTCNEAKEVMLEIMGGKTTPTQNAAFLAALS
FT                   TKSTKAETIDEIYGCAEAMRSLATPVPHPGMEVMEIVGTGGDGAHSFNISTTSAMVLAA
FT                   GGVKVAKHGNRAASSLCGTADCLEALGVNIQQDPALALKMLQETNFCFLFAQKYHAAMK
FT                   YVGPIRKELGFRTVFNILGPLTNPAKPEMFLLGVYDGYLVEPLAKVLCSLGVKRGLVGY
FT                   GQEKLDEISPNGPTTICELRDGYYRSSVIRPEDFGLVPGKKEDLIGGAPEENARITRDI
FT                   LSGKHQGTKRNAVLLNAGAGLFVAGKADTLAGGVKLAGELIDSGKALAALEKVVKVSNE
FT                   "
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /protein_id="YP_003398004.1"
FT   misc_feature    335283..336302
FT                   /note="anthranilate phosphoribosyltransferase; Provisional;
FT                   Region: trpD; PRK00188"
FT                   /db_xref="CDD:166844"
FT                   /locus_tag="Acfer_0283"
FT   misc_feature    335283..335489
FT                   /note="Glycosyl transferase family, helical bundle domain;
FT                   Region: Glycos_trans_3N; pfam02885"
FT                   /db_xref="CDD:145834"
FT                   /locus_tag="Acfer_0283"
FT   misc_feature    335514..336266
FT                   /note="Glycosyl transferase family, a/b domain; Region:
FT                   Glycos_transf_3; pfam00591"
FT                   /db_xref="CDD:144256"
FT                   /locus_tag="Acfer_0283"
FT   gene            336322..337107
FT                   /db_xref="GeneID:8736729"
FT                   /locus_tag="Acfer_0284"
FT   CDS_pept        336322..337107
FT                   /locus_tag="Acfer_0284"
FT                   /gene_family="HOG000230462" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.48"
FT                   /transl_table="11"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   cce:Ccel_3216 indole-3-glycerol phosphate synthase"
FT                   /db_xref="GI:284047666"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="GeneID:8736729"
FT                   /translation="MILDTLAEATRQRVEKQKKEKDFFTLRREAEALPRDRAGCFRKAL
FT                   EKPGLNFITEVKKASPSKGLIALDFPYVAIARQYEALGAAAISVLTETDHFLGSDRYLR
FT                   EIRQAVATPLLRKDFTIDAYMVVQARTLGADAILLIAAILSDSQLEEYRLMAESLGMDA
FT                   LVEAHDEEEVERALRSGARVLGVNNRNLKDFTVDIGNSLRLRPRVPKNIPFVAESGIKS
FT                   RQQTAALEQAGVNGVLIGETLMRSPDMKAALAELRGEIL"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /protein_id="YP_003398005.1"
FT   misc_feature    336442..337089
FT                   /note="Indole-3-glycerol phosphate synthase (IGPS); an
FT                   enzyme in the tryptophan biosynthetic pathway, catalyzing
FT                   the ring closure reaction of
FT                   1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP)
FT                   to indole-3-glycerol phosphate (IGP), accompanied by
FT                   the...; Region: IGPS; cd00331"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   misc_feature    order(336484..336486,336490..336492,336499..336507,
FT                   336607..336609,336670..336672,336676..336678,
FT                   336739..336741,336817..336819,336880..336882,
FT                   336886..336888,336892..336894,336973..336978,
FT                   337039..337044)
FT                   /note="active site"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   misc_feature    order(336484..336486,336490..336492,336670..336672,
FT                   336817..336819,336880..336882)
FT                   /note="ribulose/triose binding site; other site"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   misc_feature    order(336490..336492,336976..336978,337039..337044)
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   misc_feature    order(336502..336504,336607..336609,336886..336888,
FT                   336892..336894)
FT                   /note="substrate (anthranilate) binding pocket; other site"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   misc_feature    order(336607..336609,336670..336672,336676..336678,
FT                   336739..336741,336892..336894)
FT                   /note="product (indole) binding pocket; other site"
FT                   /db_xref="CDD:73363"
FT                   /locus_tag="Acfer_0284"
FT   gene            337104..337730
FT                   /db_xref="GeneID:8736730"
FT                   /locus_tag="Acfer_0285"
FT   CDS_pept        337104..337730
FT                   /locus_tag="Acfer_0285"
FT                   /gene_family="HOG000161598" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.24"
FT                   /transl_table="11"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: cce:Ccel_3217 N-
FT                   (5'phosphoribosyl)anthranilate isomerase (PRAI)"
FT                   /db_xref="GI:284047667"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736730"
FT                   /translation="MTKIKLCGLRRLEDVAMVNRARPDYAGFVFAPGKRQVTADEAEIL
FT                   RQQLDPAIAAVGVFVKAPVEEAVALANRGIIQLIQLHGDEEEAYVKELRWRTKASIIRV
FT                   LRVRGPESLRDLDRYDCDYFLLDTFSGNAFGGVGRTFDHSLLRQVRFPRPFFLAGGLDP
FT                   ENVKAAIEQVGPYGVDTSSGIETAGRKDETKIRAFVSAVRKEEKP"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /protein_id="YP_003398006.1"
FT   misc_feature    337113..337709
FT                   /note="Phosphoribosylanthranilate isomerase (PRAI)
FT                   catalyzes the fourth step of the tryptophan biosynthesis,
FT                   the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA)
FT                   to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate
FT                   (CdRP). Most PRAIs are monomeric...; Region: PRAI; cd00405"
FT                   /db_xref="CDD:73365"
FT                   /locus_tag="Acfer_0285"
FT   misc_feature    order(337116..337118,337122..337124,337188..337190,
FT                   337341..337343,337347..337349,337482..337484,
FT                   337638..337640,337644..337649)
FT                   /note="active site"
FT                   /db_xref="CDD:73365"
FT                   /locus_tag="Acfer_0285"
FT   gene            337727..338911
FT                   /db_xref="GeneID:8736731"
FT                   /locus_tag="Acfer_0286"
FT   CDS_pept        337727..338911
FT                   /locus_tag="Acfer_0286"
FT                   /gene_family="HOG000161710" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /codon_start="1"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: cth:Cthe_1412 tryptophan synthase subunit beta"
FT                   /db_xref="GI:284047668"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="GeneID:8736731"
FT                   /translation="MSKGRFGRHGGQYVSETLMNAVLQLEEAYNRFKDDPEFLQELRTL
FT                   YHDYANRPSLLYYAEKMTKDLGGAKIYLKREDLNHTGAHKINNALGQCLLAKKMGKKRV
FT                   IAETGAGQHGVATATVAALMGLECEVYMGREDTIRQALNVYRMELLGAKVVPVTTGTGT
FT                   LKDAVSEAMRDWCTNVEDTFYVLGSCMGPHPYPTIVRDFQKVIGEEVKAQILEKEGRLP
FT                   DVVMACVGGGSNAIGLFYDFIPDRDVQLIGVEAAGRGVNTAETAATIARGKPGIFHGME
FT                   SYFLQDEDGQIAPVYSISAGLDYPGIGPEHANLYDTGRAQYVPITDDESVEAFEYLSRT
FT                   EGIIPAIESAHAVAYAMKLAPTLPKDKIIVVNLSGRGDKDVAAIARYKGVDLHD"
FT                   /protein_id="YP_003398007.1"
FT   misc_feature    337787..338878
FT                   /note="Tryptophan synthase-beta:  Trptophan synthase is a
FT                   bifunctional enzyme that catalyses the last two steps in
FT                   the biosynthesis of L-tryptophan via its alpha and beta
FT                   reactions. In the alpha reaction, indole 3-glycerol
FT                   phosphate is cleaved reversibly to...; Region: Trp-synth_B;
FT                   cd06446"
FT                   /db_xref="CDD:107207"
FT                   /locus_tag="Acfer_0286"
FT   misc_feature    337925..338863
FT                   /note="Cysteine synthase [Amino acid transport and
FT                   metabolism]; Region: CysK; COG0031"
FT                   /db_xref="CDD:30381"
FT                   /locus_tag="Acfer_0286"
FT   misc_feature    order(337976..337981,338060..338062,338288..338290,
FT                   338414..338428,338768..338770,338846..338848)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:107207"
FT                   /locus_tag="Acfer_0286"
FT   misc_feature    337979..337981
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107207"
FT                   /locus_tag="Acfer_0286"
FT   gene            338904..339686
FT                   /db_xref="GeneID:8736732"
FT                   /locus_tag="Acfer_0287"
FT   CDS_pept        338904..339686
FT                   /locus_tag="Acfer_0287"
FT                   /gene_family="HOG000223816" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.20"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_1411 tryptophan synthase, alpha
FT                   chain; TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="GI:284047669"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736732"
FT                   /translation="MTRITDAFKKQGKLFIPFITAGDPDLATTEKLIYAMEEAGAGLIE
FT                   IGIPFSDPTAEGPVILEADTRALAAGTKIKDIFAMLARVREKTRIPMVFLTYANPIFTY
FT                   GRDKFFQQCRDVEIDGVIVPDVPFEEKATIAPEAEKYGVEIISMIAPTSHQRIQMIAKE
FT                   AQGYIYLVSSLGVTGVRKEITTNLKEIVEKIREVSDKPIAVGFGISTPEQAREMAAISD
FT                   GAIVGSAIVKLCAQYGKDCVEPVKQYVKKMAEAVDEAK"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /protein_id="YP_003398008.1"
FT   misc_feature    338904..339671
FT                   /note="tryptophan synthase alpha subunit; Provisional;
FT                   Region: trpA; CHL00200"
FT                   /db_xref="CDD:133642"
FT                   /locus_tag="Acfer_0287"
FT   misc_feature    338943..339662
FT                   /note="Ttryptophan synthase (TRPS) alpha subunit (TSA).
FT                   TPRS is a bifunctional tetrameric enzyme (2 alpha and 2
FT                   beta subunits) that catalyzes the last two steps of
FT                   L-tryptophan biosynthesis. Alpha and beta subunit catalyze
FT                   two distinct reactions which are...; Region:
FT                   Tryptophan_synthase_alpha; cd04724"
FT                   /db_xref="CDD:73386"
FT                   /locus_tag="Acfer_0287"
FT   misc_feature    order(339036..339038,339069..339071,339081..339083,
FT                   339408..339410,339432..339437,339519..339524,
FT                   339582..339587)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73386"
FT                   /locus_tag="Acfer_0287"
FT   misc_feature    order(339036..339038,339069..339071,339192..339194,
FT                   339432..339434)
FT                   /note="active site"
FT                   /db_xref="CDD:73386"
FT                   /locus_tag="Acfer_0287"
FT   misc_feature    order(339036..339038,339069..339071,339192..339194)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:73386"
FT                   /locus_tag="Acfer_0287"
FT   misc_feature    order(339051..339062,339066..339068,339075..339077,
FT                   339084..339089,339198..339200,339207..339209,
FT                   339273..339278,339282..339284,339291..339293,
FT                   339351..339353,339357..339362,339369..339371)
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:73386"
FT                   /locus_tag="Acfer_0287"
FT   gene            340070..341446
FT                   /db_xref="GeneID:8736733"
FT                   /locus_tag="Acfer_0288"
FT   CDS_pept        340070..341446
FT                   /locus_tag="Acfer_0288"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /codon_start="1"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   sth:STH1883 LytR family transcriptional regulator"
FT                   /db_xref="GI:284047670"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="GeneID:8736733"
FT                   /translation="MLAKYKALIAGITALVVAVAGFFLLGQEKKTDPGQTAQIHGKRNI
FT                   LVLGVDRRTGDTGRSDTLFVTMLDTSRNQAALLSIPRDTLVPIPGHGWDKVNHVYAYGG
FT                   QELSRKTLENFLGIRISNYVLVDFQGFIKLVDAIGGVDIDVEKPMQYTDPYDGEKGLVI
FT                   SLQPGKQHMDGTTAIQYVRYRDEEGDIGRVVRQQKFMKAVFARLRSASLLTRAPEIAHT
FT                   LYQSIDTDLSVTDLASLLVTFAKNVSGTSQLETAMVQGSPAYIDDLSYWIPNMTALRQQ
FT                   VARLQGEEPGEGYRLAAQAAKKKYDELLGTNSAAGSGEKRKIEIRSQELKKAVEQSRKM
FT                   DGEKAGMPAGNGSSAARERTAPNLPPPPQKNLKASLVNCSGNPRYGVEAANDARNAGFS
FT                   IVSITNGSPMDRTQVLINAGSTAAEERTGALPFDFQLIQGAVSPSSGDVVIYVGKDYGK
FT                   "
FT                   /protein_id="YP_003398009.1"
FT   misc_feature    340073..340933
FT                   /note="Cell envelope-related transcriptional attenuator
FT                   domain; Region: LytR_cpsA_psr; cl00581"
FT                   /db_xref="CDD:174294"
FT                   /locus_tag="Acfer_0288"
FT   gene            341726..341905
FT                   /db_xref="GeneID:8736734"
FT                   /locus_tag="Acfer_0289"
FT   CDS_pept        341726..341905
FT                   /locus_tag="Acfer_0289"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047671"
FT                   /db_xref="GeneID:8736734"
FT                   /translation="MGFEEILQLLMDVLFPPTLGFLFRLDVELTIAAFLLTTAFYVVLV
FT                   VPLFYLYIRMGGML"
FT                   /protein_id="YP_003398010.1"
FT   gene            342012..342878
FT                   /db_xref="GeneID:8736735"
FT                   /locus_tag="Acfer_0290"
FT   CDS_pept        342012..342878
FT                   /locus_tag="Acfer_0290"
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /codon_start="1"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Shikimate dehydrogenase substrate binding
FT                   domain protein; Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   mta:Moth_1558 shikimate dehydrogenase"
FT                   /db_xref="GI:284047672"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736735"
FT                   /translation="MHIDIHTRFITLLGDPLAQSFAARMQNRGYEAAGLNLVYFYTITG
FT                   QEHLGDIVNGLRYMPVAGFAVTKPNKVKVLEYLDELDPLCRKMGSSNTVVKLPDGRLKG
FT                   YNTDGTGFYTALTEAGIDVTKERFFCFGSGGAGRAMCSVLAYHGATKIWITDLFPESAR
FT                   SLVEDINKNFAPVAEMVPYEDFSKVGEATVVLNASGVGMGQSIGKTPLPPEFIQKDQFY
FT                   FDACYNPARTRFLENAEKAGCRVMNGLTMSLYQGTAQVELWSGQKAPEEAMRRELEKIL
FT                   EEKKQQD"
FT                   /protein_id="YP_003398011.1"
FT   misc_feature    342018..342836
FT                   /note="Shikimate 5-dehydrogenase [Amino acid transport and
FT                   metabolism]; Region: AroE; COG0169"
FT                   /db_xref="CDD:30518"
FT                   /locus_tag="Acfer_0290"
FT   misc_feature    342045..342293
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="Acfer_0290"
FT   misc_feature    342330..342806
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Acfer_0290"
FT   misc_feature    order(342333..342335,342690..342692,342765..342767,
FT                   342774..342776)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Acfer_0290"
FT   misc_feature    order(342408..342410,342417..342419,342477..342482,
FT                   342600..342608,342684..342686,342753..342755,
FT                   342762..342767)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="Acfer_0290"
FT   gene            342907..343527
FT                   /db_xref="GeneID:8736736"
FT                   /locus_tag="Acfer_0291"
FT   CDS_pept        342907..343527
FT                   /locus_tag="Acfer_0291"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /codon_start="1"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /transl_table="11"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bha:BH2672
FT                   C4-dicarboxylate transport system (permease small protein)"
FT                   /db_xref="GI:284047673"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="GeneID:8736736"
FT                   /translation="MESMMMENVKESSKAVQQKNSLNALIHWLDLHLEETFLVVMLVLI
FT                   AGVTMLQVIVRKIPGMASLTWAEELCRFLWIWSVFLSLPYTIRTDSMLRVGVLKDLLPE
FT                   TLRKVLNLAVDGITLGCMSVLGLYGVEVVSVIGESHEISPAMQWPMAFVYSFMVLGFFL
FT                   AALRAVQMLWFHVQHLQEPELSTLEQTLRDAADETALAQEGDD"
FT                   /protein_id="YP_003398012.1"
FT   misc_feature    343039..343425
FT                   /note="Tripartite ATP-independent periplasmic transporters,
FT                   DctQ component; Region: DctQ; cl01181"
FT                   /db_xref="CDD:174571"
FT                   /locus_tag="Acfer_0291"
FT   gene            343530..344825
FT                   /db_xref="GeneID:8736737"
FT                   /locus_tag="Acfer_0292"
FT   CDS_pept        343530..344825
FT                   /locus_tag="Acfer_0292"
FT                   /gene_family="HOG000266924" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /codon_start="1"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: ere:EUBREC_2838 hypothetical
FT                   protein"
FT                   /db_xref="GI:284047674"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="GeneID:8736737"
FT                   /translation="MQAVLIFSVFLLAIALSLPIGISMILGATAPIALFHQGGTMGQVL
FT                   NNAFSGANSTPILAVPLFILGGVIMAKGGISRKLFNFFAFFAGRIPGGLPCAVILTCLF
FT                   YGAISGSGPATTAAVGAMCVPFLTELGYDKTWSAGLVAVAGGLGVIIPPSIPFVLYSLA
FT                   TGVSTGKLFLAGIIPGFLVGLALMVYAVIHCLRNGEDKAKVRERMDELSRLGFFRLFRD
FT                   SSWALLCPVIVLGGIYTGFTTPTEAAAVSVFYALLVSLFVYRTMTFGDILPMLRESVRT
FT                   YGGLAFVLAFATAFGRVLSMTRATKVVESFILGNFTSGVAVLTVLVLIFLLLGMVMDTG
FT                   PAIIILVPVLLPACKKLGVDPVHLGVVLVCCLSIGLATPPFGLDLFVAGNIAGKQPMSV
FT                   ARKSIPFICAFLAALVGITYIPALSTFLPALW"
FT                   /protein_id="YP_003398013.1"
FT   misc_feature    343548..344798
FT                   /note="DctM-like transporters; Region: DctM; pfam06808"
FT                   /db_xref="CDD:148424"
FT                   /locus_tag="Acfer_0292"
FT   misc_feature    343674..344819
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0292"
FT   gene            344854..345921
FT                   /db_xref="GeneID:8736738"
FT                   /locus_tag="Acfer_0293"
FT   CDS_pept        344854..345921
FT                   /locus_tag="Acfer_0293"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /codon_start="1"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: ere:EUBREC_2837 hypothetical protein"
FT                   /db_xref="GI:284047675"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="GeneID:8736738"
FT                   /translation="MEKPWKKLAGLCLAGLLLFGVTACGKAPAAAKPEEKTAGPYKNLP
FT                   QVVLVGGDSAGKGSVGQKFGELVARKVEEKSGGRLKIDYHPNAELGGDEDLLRQLRAND
FT                   IQLVVGQMAPVTAFVPEGAVFDLPMVFAPYDGKTIDRVLNGPGPFRQKLAAAYEKAGLH
FT                   YMGTLQNGTYRLMTSNRPVKTVEDFRGLKIRTMSNRNHMAFWSALGANPTPLAWPELYF
FT                   SLQSGIVDAEENAADSILSANFNEVQKYVGETNVILYANEMVLNQKAWDSLPEAYRQVL
FT                   DQSVREALEELSPTLVQVDRDCKEKLQKKGMTLVTYGPEFYQEVRNQPAVQELYKKIDA
FT                   QTGGLGTLMVEELGK"
FT                   /protein_id="YP_003398014.1"
FT   misc_feature    344992..345912
FT                   /note="Bacterial extracellular solute-binding protein,
FT                   family 7; Region: SBP_bac_7; cl00710"
FT                   /db_xref="CDD:153950"
FT                   /locus_tag="Acfer_0293"
FT   gene            complement(345997..346749)
FT                   /db_xref="GeneID:8736739"
FT                   /locus_tag="Acfer_0294"
FT   CDS_pept        complement(345997..346749)
FT                   /locus_tag="Acfer_0294"
FT                   /gene_family="HOG000105514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01093"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.10"
FT                   /transl_table="11"
FT                   /note="KEGG: kpn:KPN_00073 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I; PFAM:
FT                   dehydroquinase class I"
FT                   /db_xref="GI:284047676"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736739"
FT                   /translation="MAQPVLVKNLAIGEGQPKIAVPLTAPTLSGLEEALDQLAECPCDL
FT                   VEWRADCYGPIREPGSWKAPLALFRERIPHLPLLFTIRTAAEGGNLAISTEAYVQLLEE
FT                   AMDSGAMDLADVELSRGSQVMERLVDRAHRKGIKVVGSCHDFQKTPSREALVRTLCAMQ
FT                   DLGCDLAKYAVMPQTEQDVLTLLAATLEMKEEHPRTPVITMSMGAMGAVTRIGGGRFGS
FT                   AVTFATAGPASAPGQLPADLLAQVLPRV"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /protein_id="YP_003398015.1"
FT   misc_feature    complement(346009..346698)
FT                   /note="Type I 3-dehydroquinase, (3-dehydroquinate
FT                   dehydratase or DHQase.) Catalyzes the cis-dehydration of
FT                   3-dehydroquinate via a covalent imine intermediate to
FT                   produce dehydroshikimate. Dehydroquinase is the third
FT                   enzyme in the shikimate pathway, which is...; Region:
FT                   DHQase_I; cd00502"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="Acfer_0294"
FT   misc_feature    complement(346009..346698)
FT                   /note="3-dehydroquinate dehydratase, type I; Region: aroD;
FT                   TIGR01093"
FT                   /db_xref="CDD:162199"
FT                   /locus_tag="Acfer_0294"
FT   misc_feature    complement(order(346039..346041,346048..346053,
FT                   346108..346110,346237..346239,346318..346320,
FT                   346501..346503,346603..346605,346609..346611,
FT                   346684..346686))
FT                   /note="active site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="Acfer_0294"
FT   misc_feature    complement(346237..346239)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="Acfer_0294"
FT   misc_feature    complement(order(346012..346014,346024..346026,
FT                   346090..346092,346102..346107,346180..346182,
FT                   346189..346191,346201..346203))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="Acfer_0294"
FT   gene            346997..348553
FT                   /db_xref="GeneID:8736740"
FT                   /locus_tag="Acfer_0295"
FT   CDS_pept        346997..348553
FT                   /locus_tag="Acfer_0295"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03606"
FT                   /codon_start="1"
FT                   /product="C4-dicarboxylate anaerobic carrier-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier-like; KEGG:
FT                   sub:SUB1326 C4-dicarboxylate anaerobic carrier protein"
FT                   /db_xref="GI:284047677"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="GeneID:8736740"
FT                   /translation="MADQPKKQRKMLSSYSIVFLFLIFTAILTWFVPQSVVINDHGTKK
FT                   IIYDAILVKGKVMAGQGLQPMGLWDIIMAPAKGFVKAAQLCFALLMAGAFLHLLNYVGA
FT                   MRAGIGWLLKRFTGKTLIVVLTFFSALFGAVYGLWEEIPAYSMAVVPLFVLAGYDVVTG
FT                   IGVLTVGATAGNMASVVNPFSLGAAVGAIGNESLSLGSGIVLRLVLFAVLYLVALAYVL
FT                   QYAARVKKDPSRSIVAGLPVNTMVEERQEEVEITSRQALSIGLLVLIVIAMICGYVPWD
FT                   SIKFADGTTAKTLVNLPFTTLAKVPVLGNLLGAEHYTQFGDWYFEEFSFVFLAGALLLG
FT                   IINKIPEATFIKEFIAGARDLLSVVLVLAIANGISVIMGSKTAGMSVTFVYWIQNALQG
FT                   VPSWAFSLAVILSYVAIGFFMQSTSGVAGITMPILGAVAYALYETAPIGPVGGQVLLIA
FT                   SFTIGLNFTSALYPSATNMGTLELYKVPYDIYLKFILKGALLLLVTGGIIVSVAPMLGI
FT                   L"
FT                   /protein_id="YP_003398016.1"
FT   misc_feature    346997..348541
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1288"
FT                   /db_xref="CDD:31479"
FT                   /locus_tag="Acfer_0295"
FT   misc_feature    347009..348544
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0295"
FT   gene            348604..350043
FT                   /db_xref="GeneID:8736741"
FT                   /locus_tag="Acfer_0296"
FT   CDS_pept        348604..350043
FT                   /locus_tag="Acfer_0296"
FT                   /gene_family="HOG000282306" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01893"
FT                   /codon_start="1"
FT                   /EC_number="3.4.13.3"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0889 aminoacyl-histidine
FT                   dipeptidase; TIGRFAM: aminoacyl-histidine dipeptidase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="GI:284047678"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="GeneID:8736741"
FT                   /translation="MTVLDSLEPRRVFHFFEEISRIPHGSGHTKAISDWLVEFGRKRGL
FT                   EVRQDALNNVVLVGPASPGYEQAEPVIFQGHMDMVCEKAPDCPKDMEKEGLDLEVSGDE
FT                   ITARGTTLGADDGIAVAMGLALLDDPSIPRPRLEAVFTVDEEIGMLGAVDLDASGLAGR
FT                   RMINMDSEEEGVFTAGCAGGVDVNCALPVRREAFAGTCLELKISGLTGGHSGAEIHKGR
FT                   ANGDRLMGRLLLHLDREVLYRLVEVEGGTKDNAIPREARAAVLTPEPEKLRQAVAAFDR
FT                   ILRQEFQVTDPDLQVTAEPARAERLPMDRESTEKVQCLLTSLPGGVQVMSPELEGMVQT
FT                   SLNLGILYTEDGQVCAGLLVRSSVESQKEMVAEQIEGLLRQLGGQAIRSGDYPGWAYRA
FT                   DSPLRDLFVQVYREQYGKEPKVEAIHAGVECGMFAAKLPGLDCISLGPTLTEIHTYRET
FT                   MHIASVQRTWNLLLEVLKRMK"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /protein_id="YP_003398017.1"
FT   misc_feature    348622..350040
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Acfer_0296"
FT   gene            350055..350624
FT                   /db_xref="GeneID:8736742"
FT                   /locus_tag="Acfer_0297"
FT   CDS_pept        350055..350624
FT                   /locus_tag="Acfer_0297"
FT                   /gene_family="HOG000132549" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_20105"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_20105 hypothetical protein"
FT                   /db_xref="GI:284047679"
FT                   /db_xref="GeneID:8736742"
FT                   /translation="MNDMEQRTQAIIEACAQEKETNPLAIFRHVASRDFVRIHGPEHHV
FT                   LDGACLLTALHNAGMEFDLRELLGRLRQEGLQMPGAICGHWGVCGAVASIGAALALLEE
FT                   TGPLTTDSSWGSHMTCTARALANLAAIGGPRCCKRDAYTALKTAIPYVKERFGITLPEE
FT                   KTVCGFYPRNQQCLEERCPYNPQFCD"
FT                   /protein_id="YP_003398018.1"
FT   gene            350735..352375
FT                   /db_xref="GeneID:8736743"
FT                   /locus_tag="Acfer_0298"
FT   CDS_pept        350735..352375
FT                   /locus_tag="Acfer_0298"
FT                   /gene_family="HOG000159796" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 39"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   ote:Oter_1409 glycosyl transferase family protein"
FT                   /db_xref="GI:284047680"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="GeneID:8736743"
FT                   /translation="MKKKYWLGFWAAAVFLLFFMNSSLPLTDSVEGNYALTAKEMVLSG
FT                   DWLSPQIYGRYWYDKPVFAYWMIALGFKIFGFSEFGARFFPSLFGLGGLWLTVQAGKRL
FT                   YREEVGFLSGVLLLMTLEFFTISKSVLTDGMLFLFMDGALLCFFLGYSSREKNWYYGVY
FT                   LLSALATLTKGPIGFLMPGFIITLFLLYQKDWKCLKDAKLATGIPLFLLVALPWYIAMA
FT                   RVHPDFLGSFLGTQNVLRATVSEHPRDNVIWYYTAVNILNAYAWVGFVPGMLWNLLRKN
FT                   GKWNYPAAREAFLLLWMAAIFVFFQCMATKYITYTYPLLLPLCVLTADYIWKKGSSLPL
FT                   KGMLLCNILFYGALTFAASKVTKLAPGVFPNPGNLFYFMLIYTLCMVVLAFHKYKGKSS
FT                   QEVFSTVVMLTIAFHCCSLDLLAKPLMEDVTGKTAAQFINALVPADMPIYIRGGGYPTS
FT                   GVFYTGREMVMLVPDEEAEAFKPRQDSWSAKNIMPWTTYGQVREQQGKALVLVDTKTRK
FT                   LKTKLEEDWPGTWKRVKLPGQWTVMIKER"
FT                   /protein_id="YP_003398019.1"
FT   misc_feature    350735..>351649
FT                   /note="Dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase; Region: PMT; cl01961"
FT                   /db_xref="CDD:174694"
FT                   /locus_tag="Acfer_0298"
FT   gene            352382..352873
FT                   /db_xref="GeneID:8736744"
FT                   /locus_tag="Acfer_0299"
FT   CDS_pept        352382..352873
FT                   /locus_tag="Acfer_0299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047681"
FT                   /db_xref="GeneID:8736744"
FT                   /translation="MDEEKIRSYLERQEFIGFRVRQEELDHPEQLQRYFQLLEYVGSHP
FT                   ALARKFCSRWGLSFGEDCGSTLWTNPAAVAFVEKMADAFPFLFFLAEKEGETLKLLVML
FT                   TCQSDRVEGDNLSLDPEKFNRFLKQQLKGLLLLSEKAGLSPENAQGLIQNIYEYFGLSD
FT                   "
FT                   /protein_id="YP_003398020.1"
FT   gene            complement(353063..353944)
FT                   /db_xref="GeneID:8736745"
FT                   /locus_tag="Acfer_0300"
FT   CDS_pept        complement(353063..353944)
FT                   /locus_tag="Acfer_0300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gme:Gmet_1684 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:284047682"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736745"
FT                   /translation="MKLHQLRYFQEVCRQHSITKAAEELHISQPAVSAAIRELEEEFGL
FT                   KLFKRSHKKLVLTTEGSYFSLEVEELLQKANQIADDMTRLQKKNTSIRVGLPPMMEALE
FT                   IPFLALFHRKHPEIRLELHHGNSLSLRKALQDGRIDIAIVSGKGADQDDMATRAMKHCE
FT                   IVYCVSRSHPLARETAISIPQLAQEDLVEIENSQKFRETVLERFHQDHCTPRIQWSTSQ
FT                   LYTKIQLLRSGVAGGFLYRAVAEREPDLVPLSLTPPLYYEIEMLWQNSALENETIRTFL
FT                   EFAQEHGTIEKP"
FT                   /protein_id="YP_003398021.1"
FT   misc_feature    complement(353084..353944)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Acfer_0300"
FT   misc_feature    complement(353762..353938)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0300"
FT   misc_feature    complement(353093..353674)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0300"
FT   misc_feature    complement(order(353249..353254,353258..353263,
FT                   353279..353296,353573..353593,353597..353599,
FT                   353609..353611,353618..353623,353627..353629))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Acfer_0300"
FT   gene            354217..354777
FT                   /db_xref="GeneID:8736746"
FT                   /locus_tag="Acfer_0301"
FT   CDS_pept        354217..354777
FT                   /locus_tag="Acfer_0301"
FT                   /gene_family="HOG000246867" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /codon_start="1"
FT                   /product="BioY protein"
FT                   /transl_table="11"
FT                   /note="PFAM: BioY protein; KEGG: dae:Dtox_4332 BioY
FT                   protein"
FT                   /db_xref="GI:284047683"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="GeneID:8736746"
FT                   /translation="MKENHAPLALCGLFTALMAVGAFIHIMVPLGIWQVTISLQIFVAV
FT                   LAGLFLGRRLGFLSVLAYLVLGLAGLPVFAHGGGLGYLMKPTFGFLLGFPCAAWMTGLL
FT                   AGNPSRAGLKRLLGAAFGGEMVYYACGLVYYDVMFNLVLQNTGGIGLVRLLEIWFLSTV
FT                   LPDWVLCALAVLVYRKLAPMVRR"
FT                   /protein_id="YP_003398022.1"
FT   misc_feature    <354430..354768
FT                   /note="BioY family; Region: BioY; cl00560"
FT                   /db_xref="CDD:153855"
FT                   /locus_tag="Acfer_0301"
FT   gene            354779..355645
FT                   /db_xref="GeneID:8736747"
FT                   /locus_tag="Acfer_0302"
FT   CDS_pept        354779..355645
FT                   /locus_tag="Acfer_0302"
FT                   /gene_family="HOG000228588" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.61"
FT                   /transl_table="11"
FT                   /note="KEGG: saf:SULAZ_0549 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="GI:284047684"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="GeneID:8736747"
FT                   /translation="MKKLIVATRGSRLALAQTHIVCRLLEEAGVETEIRTITTAGDRDR
FT                   IHALVKIGGRGIFVREIERELLSGEADIAVHSAKDLPYQLASGLVIAGTPSQADPRDAL
FT                   VLLKERKLEAGSVVGTGSPRRIREISRVLPELVFRDIRGNVTTRLHKLERGEYDAIVLA
FT                   MAGIQRLALDMEQFQIRPLSTEQVIPAGCQGIIGVECRQKDRELVRLLQQISDPETWRR
FT                   FQWERQLFTSMKVDCSRPVGIHCRLLKSGRMELLAMVDGKRARRLGMEKEGKALCASLK
FT                   EELYDRK"
FT                   /product="porphobilinogen deaminase"
FT                   /protein_id="YP_003398023.1"
FT   misc_feature    354779..355639
FT                   /note="porphobilinogen deaminase; Reviewed; Region: hemC;
FT                   PRK00072"
FT                   /db_xref="CDD:166764"
FT                   /locus_tag="Acfer_0302"
FT   misc_feature    354788..355636
FT                   /note="Hydroxymethylbilane synthase (HMBS), also known as
FT                   porphobilinogen deaminase (PBGD), is an intermediate enzyme
FT                   in the biosynthetic pathway of tetrapyrrolic ring systems,
FT                   such as heme, chlorophylls, and vitamin B12. HMBS catalyzes
FT                   the conversion of...; Region: HMBS; cl03189"
FT                   /db_xref="CDD:155337"
FT                   /locus_tag="Acfer_0302"
FT   misc_feature    order(354809..354811,354824..354826,355010..355027,
FT                   355031..355033,355058..355063,355067..355084,
FT                   355148..355150,355154..355159,355169..355171,
FT                   355208..355210,355271..355273,355280..355285,
FT                   355337..355360,355412..355414,355433..355435,
FT                   355442..355444,355454..355459,355466..355468,
FT                   355487..355489,355499..355501,355505..355507,
FT                   355544..355546,355559..355561,355568..355570)
FT                   /note="domain interfaces; other site"
FT                   /db_xref="CDD:29604"
FT                   /locus_tag="Acfer_0302"
FT   misc_feature    order(354815..354817,354827..354829,355007..355009,
FT                   355013..355018,355136..355144,355148..355153,
FT                   355199..355201,355220..355222,355259..355267,
FT                   355274..355276,355283..355285,355346..355348,
FT                   355355..355360,355487..355489)
FT                   /note="active site"
FT                   /db_xref="CDD:29604"
FT                   /locus_tag="Acfer_0302"
FT   gene            355632..357101
FT                   /db_xref="GeneID:8736748"
FT                   /locus_tag="Acfer_0303"
FT   CDS_pept        355632..357101
FT                   /locus_tag="Acfer_0303"
FT                   /gene_family="HOG000290968" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /codon_start="1"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; Uroporphyrinogen III synthase HEM4;
FT                   KEGG: mta:Moth_1248 uroporphyrinogen-III C-
FT                   methyltransferase / uroporphyrinogen-III synthase"
FT                   /db_xref="GI:284047685"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="GeneID:8736748"
FT                   /translation="MTENKGPAGEVWLVGAGCGRGLLTREGRETLARAHTVLYDALVPL
FT                   DGLREINPRAEWLPVGKRSGRHSMDQESINGLLIRKAREGKMVVRLKGGDSFVFGRGGE
FT                   EALALQAAGISWHVVPGVSSSIAVPEHFGIPVTHRGLARSFTVVTGHTRDGQEEDWQAL
FT                   ARLQGTLVFLMGLERLETICRRLILEGKAPDTPASILCGGYTSQEIRLDGTLADLPEKA
FT                   RAQGAFAPAIILVGPVAGLGLRPAREDDPEKILVTGTPVFCGEVARALASVGKTVTELP
FT                   ILELEPLFQNIPEDFDRYGWLVFTSRNGVRLFFRWFRSARQDFRRLGQVRFACIGQGTA
FT                   EELADQGFQADLMPEVFTAEDLGRLLGETLEAGDRCLLLRAEEGSPDLVRELDRAGRKY
FT                   RDVPLYRIRTRKILTGAETRLAPQVMIFGSGRGVREFFRRFTLAPETRVLCIGPVTARA
FT                   AREAGCSQVETAAIHSAAGIRDALEKKGSRP"
FT                   /protein_id="YP_003398024.1"
FT   misc_feature    355662..356354
FT                   /note="Tetrapyrrole (Corrin/Porphyrin) Methylases; Region:
FT                   TP_methylase; cl00304"
FT                   /db_xref="CDD:174096"
FT                   /locus_tag="Acfer_0303"
FT   misc_feature    356391..357077
FT                   /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
FT                   asymmetrical cyclization of tetrapyrrole (linear) to
FT                   uroporphyrinogen-III, the fourth step in the biosynthesis
FT                   of heme. This ubiquitous enzyme is present in eukaryotes,
FT                   bacteria and archaea. Mutations...; Region: HemD; cd06578"
FT                   /db_xref="CDD:119440"
FT                   /locus_tag="Acfer_0303"
FT   misc_feature    order(356403..356405,356547..356555,356643..356645,
FT                   356772..356774,356844..356846,356850..356852,
FT                   356913..356927)
FT                   /note="active site"
FT                   /db_xref="CDD:119440"
FT                   /locus_tag="Acfer_0303"
FT   misc_feature    356430..357065
FT                   /note="Uroporphyrinogen-III synthase HemD; Region: HEM4;
FT                   pfam02602"
FT                   /db_xref="CDD:145641"
FT                   /locus_tag="Acfer_0303"
FT   gene            357098..357676
FT                   /db_xref="GeneID:8736749"
FT                   /locus_tag="Acfer_0304"
FT   CDS_pept        357098..357676
FT                   /locus_tag="Acfer_0304"
FT                   /gene_family="HOG000285944" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /codon_start="1"
FT                   /EC_number="4.99.1.4"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: ttu:TERTU_1974
FT                   siroheme synthase"
FT                   /db_xref="GI:284047686"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8736749"
FT                   /translation="MSYFPLMIQLDQAPVLLVGGGRTAFHKARILVDFGACVRVVAPEV
FT                   LPELEQLPVQVERRPFSGADLEQSDWTLVVAATDCRTVNGQVSRLCRQRRIPVNVVDDP
FT                   ELCSFYFPALLREGEVVCAVSSGGRSPLVTQYVKEKIRQVLPAGLGWINEQMGAFRKQL
FT                   KGEETNPDKRKKRLQDKLRSLLESQEHTL"
FT                   /product="siroheme synthase"
FT                   /protein_id="YP_003398025.1"
FT   misc_feature    357107..357535
FT                   /note="precorrin-2 dehydrogenase; Validated; Region:
FT                   PRK06719"
FT                   /db_xref="CDD:136016"
FT                   /locus_tag="Acfer_0304"
FT   gene            357824..358372
FT                   /db_xref="GeneID:8736750"
FT                   /locus_tag="Acfer_0305"
FT   CDS_pept        357824..358372
FT                   /locus_tag="Acfer_0305"
FT                   /gene_family="HOG000153104" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /codon_start="1"
FT                   /product="Rubrerythrin"
FT                   /transl_table="11"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: ctc:CTC00826 rubredoxin/rubrerythrin domain-
FT                   containing protein"
FT                   /db_xref="GI:284047687"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="GeneID:8736750"
FT                   /translation="MKKFICRVCGYVYEGDEAPEKCPQCGAPKDKFDELKEGVKEYADE
FT                   HVVGVAKGVDERVLEGLRQHFTGECSEVGMYLAMSRVADREGYPEVAEAYKRIAFEEAE
FT                   HAAKFAELLGEVVTDSTKKNLEMRAAAEQGACAGKKEIATLAKQLGYDAIHDTVHEMAK
FT                   DEARHGRVFDGLLARYFAK"
FT                   /protein_id="YP_003398026.1"
FT   misc_feature    357824..357937
FT                   /note="Rubredoxin [Energy production and conversion];
FT                   Region: COG1773"
FT                   /db_xref="CDD:31959"
FT                   /locus_tag="Acfer_0305"
FT   misc_feature    357830..357928
FT                   /note="Rubredoxin_like; nonheme iron binding domain
FT                   containing a [Fe(SCys)4] center. The family includes
FT                   rubredoxins, a small electron transfer protein, and a
FT                   slightly smaller modular rubredoxin domain present in
FT                   rubrerythrin and nigerythrin and detected...; Region:
FT                   rubredoxin_like; cd00350"
FT                   /db_xref="CDD:29431"
FT                   /locus_tag="Acfer_0305"
FT   misc_feature    order(357839..357841,357848..357850,357887..357889,
FT                   357896..357898)
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29431"
FT                   /locus_tag="Acfer_0305"
FT   misc_feature    358001..358363
FT                   /note="rubrerythrin-like, diiron-binding domain; Region:
FT                   Rubrerythrin_like; cd01046"
FT                   /db_xref="CDD:153105"
FT                   /locus_tag="Acfer_0305"
FT   misc_feature    order(358028..358030,358127..358129,358136..358138,
FT                   358217..358219,358316..358318,358325..358327)
FT                   /note="diiron binding motif; other site"
FT                   /db_xref="CDD:153105"
FT                   /locus_tag="Acfer_0305"
FT   gene            358460..359089
FT                   /db_xref="GeneID:8736751"
FT                   /locus_tag="Acfer_0306"
FT   CDS_pept        358460..359089
FT                   /locus_tag="Acfer_0306"
FT                   /gene_family="HOG000010397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06555"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1121"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   eel:EUBELI_01180 hypothetical protein"
FT                   /db_xref="GI:284047688"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="GeneID:8736751"
FT                   /translation="MQEALRRRNELLAQVAIRGLASRNMKGYYAANVEEAVQKALELIP
FT                   QGSVVTMGGSTTVRESGLVERLKAGNWTFIDREEYPSRRPAHLKAYDADWYLASCNAMT
FT                   RDGILVNIDGNGNRVSAISYGPHHVLFLVSLNKVCSSLETALDRAENTAAAVCAQKFDI
FT                   QTPCRTTGFCSHCKAPETRCCEILITRYARHPERIHVILVNDQLGF"
FT                   /protein_id="YP_003398027.1"
FT   misc_feature    358724..359068
FT                   /note="Uncharacterized ACR, YkgG family COG1556; Region:
FT                   DUF162; cl00674"
FT                   /db_xref="CDD:153927"
FT                   /locus_tag="Acfer_0306"
FT   gene            359181..360227
FT                   /db_xref="GeneID:8736752"
FT                   /locus_tag="Acfer_0307"
FT   CDS_pept        359181..360227
FT                   /locus_tag="Acfer_0307"
FT                   /gene_family="HOG000117934" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00124"
FT                   /codon_start="1"
FT                   /EC_number="6.2.1.22"
FT                   /transl_table="11"
FT                   /note="KEGG: smu:SMU.1010 putative citrate lyase ligase;
FT                   TIGRFAM: citrate lyase ligase; cytidyltransferase- related
FT                   domain protein; PFAM: Citrate lyase ligase domain protein;
FT                   SMART: Citrate lyase ligase domain protein"
FT                   /db_xref="GI:284047689"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:8736752"
FT                   /translation="MSDYFISQVYPSDKRTNAQVDALLEQEGIRRDANLDYTCVMFDND
FT                   YHAIATGSCFGNTLRCMAVDHHHQGEGLMNEIVSHLVQYQYERGNLHLFLYTKCSSAKF
FT                   FGDLGFYEIARIEDQIVFMENRKDGFSSYLDNLARSRVEAPKVAAIVMNANPFTLGHQY
FT                   LVEKAAAENDLVHLFMVSEDASLFPYAVRKQLIQEGTRHLSNLRYHDSGPYIISQATFP
FT                   SYFQKDAEAVIASHANLDLAIFTKIAHRLGITVRYVGEEPTSVVTGLYNQVMQRRLPEA
FT                   GIQCIVVPRREEQGQVVSASIVRKALQEGNWALVREQVPATTLEFLQSEAARPILERIR
FT                   KEQDVVHY"
FT                   /product="citrate lyase ligase"
FT                   /protein_id="YP_003398028.1"
FT   misc_feature    359181..360218
FT                   /note="Citrate lyase synthetase [Energy production and
FT                   conversion]; Region: CitC; COG3053"
FT                   /db_xref="CDD:32867"
FT                   /locus_tag="Acfer_0307"
FT   misc_feature    359274..360161
FT                   /note="Citrate lyase ligase; Region: Citrate_lyase_ligase;
FT                   cd02169"
FT                   /db_xref="CDD:173920"
FT                   /locus_tag="Acfer_0307"
FT   misc_feature    order(359634..359639,359718..359720,359952..359954)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173920"
FT                   /locus_tag="Acfer_0307"
FT   misc_feature    359652..359663
FT                   /note="active site motif"
FT                   /db_xref="CDD:173920"
FT                   /locus_tag="Acfer_0307"
FT   gene            360447..361625
FT                   /db_xref="GeneID:8736753"
FT                   /locus_tag="Acfer_0308"
FT   CDS_pept        360447..361625
FT                   /locus_tag="Acfer_0308"
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.6"
FT                   /transl_table="11"
FT                   /note="KEGG: chy:CHY_0138 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="GI:284047690"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="GeneID:8736753"
FT                   /translation="MKKVFTSESVTEGHPDKIADQISDAVLDAILEQDPDARVACETLV
FT                   ATGQIHIVGEISTSCYVDIAKIARQTVIDIGYDRAKYGFDGSTCGVLISIDEQSPDIAQ
FT                   GVDESDESKQGAQDETEKIGAGDQGMMFGYATDETPEYMPLPISLAHKLARRLAQVRKD
FT                   GTLPYLRPDGKTQVTVEYEDDQPVRVDTIVVSAQHSPEITMEQLRKDILEQVVRPVVPA
FT                   SLLDDRTIYHINPTGRFVIGGPQGDSGLTGRKIIVDTYGGMARHGGGAFSGKDATKVDR
FT                   SAAYAARYVAKNVVAAGLAKKCEIQLAYAIGVARPVSISVNTFGTAAIPEEKIVELIEK
FT                   NFSLTPAGIIRSLDLRRPIYRQTAAYGHFGRTDVDLPWERLDKVDVLKKALE"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /protein_id="YP_003398029.1"
FT   misc_feature    360447..361619
FT                   /note="S-adenosylmethionine synthetase; Validated; Region:
FT                   PRK05250"
FT                   /db_xref="CDD:167939"
FT                   /locus_tag="Acfer_0308"
FT   misc_feature    360459..360746
FT                   /note="S-adenosylmethionine synthetase, N-terminal domain;
FT                   Region: S-AdoMet_synt_N; pfam00438"
FT                   /db_xref="CDD:144142"
FT                   /locus_tag="Acfer_0308"
FT   misc_feature    360807..361163
FT                   /note="S-adenosylmethionine synthetase, central domain;
FT                   Region: S-AdoMet_synt_M; pfam02772"
FT                   /db_xref="CDD:145757"
FT                   /locus_tag="Acfer_0308"
FT   misc_feature    361167..361586
FT                   /note="S-adenosylmethionine synthetase, C-terminal domain;
FT                   Region: S-AdoMet_synt_C; pfam02773"
FT                   /db_xref="CDD:111646"
FT                   /locus_tag="Acfer_0308"
FT   gene            361627..364020
FT                   /db_xref="GeneID:8736754"
FT                   /locus_tag="Acfer_0309"
FT   CDS_pept        361627..364020
FT                   /locus_tag="Acfer_0309"
FT                   /gene_family="HOG000037414" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /codon_start="1"
FT                   /product="primosomal protein N'"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU15710 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="GI:284047691"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:8736754"
FT                   /translation="MEYAKVAINLPAKNIFRQFTYHVPETLDFLGQGWRVVVPFGQQLL
FT                   EGFIVEEDREPDLSRELKDIADVVGTEPWFDSEMLATAYWLSQYYLCTLAEALRLFIPG
FT                   RKSLAAVGKYVPVPEAEGLSRPEQELYDFLTLKGPLPRKAIRRIPGGETALKGLIARKA
FT                   VVLSYDVKYKLREKTERTFTATPEGLAAQENGEVRGKSQQAALDLLPYGKTASAGELEA
FT                   RGITSAVLRNLVRKGWLLEGRRRVLRDSYQGLEARKETLELTEEQQAAIQAVDAARENR
FT                   EARTFLLQGITGSGKTEVYLRLAARALQAGQQVMVLVPEIALTGQIVKRFKAWFGAGVA
FT                   VAHSRLSASERGDVWSRMRSGQARVLIGVRSAVFCPFADLGLILIDEEHEGTYKQEERP
FT                   SYHARLVAQYRAHYRKVPVVLGSATPDLESYYLAEKGGYTLLRLTHRARSGSHLPKVSI
FT                   VDMREELHQGNRTVLSEALRTRLEHVVQNGEQAIVLLNRRGFSTFVLCRDCGESLSCPN
FT                   CAVSLVYHAREQLMECHYCGYTEPVPTKCPYCGSPRIRFFGTGTEKAEREIRELCPGVK
FT                   PLRMDQDSTSGKFAHEQILQAFRSGLYNVLLGTQMVAKGHDIPNVTLVGVLSADSQLNL
FT                   PDFRSGERCFALLTQAAGRAGRGDKPGEVIFQAYDAENPILQLAARQDYEGFAKMELEQ
FT                   RKELSYPPFTRMLKITVLHKKEEEALAIAQKLVNALEAWQLESGHPLEILGPFPAIVAR
FT                   VNQIYRINVLLKSPRMKPVKEWLRQSEYRELPNVYFDVDPISVV"
FT                   /protein_id="YP_003398030.1"
FT   misc_feature    361627..>362277
FT                   /note="primosome assembly protein PriA; Validated; Region:
FT                   PRK05580"
FT                   /db_xref="CDD:168108"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    362170..364011
FT                   /note="primosome assembly protein PriA; Validated; Region:
FT                   PRK05580"
FT                   /db_xref="CDD:168108"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    362476..362901
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    362503..362517
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    362782..362793
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    <363400..363624
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Acfer_0309"
FT   misc_feature    order(363475..363477,363574..363576,363586..363588,
FT                   363595..363597)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Acfer_0309"
FT   gene            364174..364650
FT                   /db_xref="GeneID:8736755"
FT                   /locus_tag="Acfer_0310"
FT   CDS_pept        364174..364650
FT                   /locus_tag="Acfer_0310"
FT                   /gene_family="HOG000243508" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.88"
FT                   /transl_table="11"
FT                   /note="KEGG: dhd:Dhaf_3853 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="GI:284047692"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="GeneID:8736755"
FT                   /translation="MAIYDIVKVGAPILREKAVPVTRFDKKLARLLKDMAETMYAANGC
FT                   GLAAPQIGLSKRLVVIDAGDGAGIREFVNPVLTDPEGEAVDSEGCLSVPDYEGEVKRAA
FT                   RITVHFQDRKGDHYRLTADGLLARALQHECDHLEGVLFIDKAVSLSAKPKEGRE"
FT                   /product="peptide deformylase"
FT                   /protein_id="YP_003398031.1"
FT   misc_feature    364189..364599
FT                   /note="Polypeptide or peptide deformylase; a family of
FT                   metalloenzymes that catalyzes the removal of the N-terminal
FT                   formyl group in a growing polypeptide chain following
FT                   translation initiation during protein synthesis in
FT                   prokaryotes. These enzymes utilize Fe...; Region:
FT                   Pep_deformylase; cd00487"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Acfer_0310"
FT   misc_feature    order(364303..364311,364324..364326,364438..364446,
FT                   364567..364572,364579..364581)
FT                   /note="active site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Acfer_0310"
FT   misc_feature    order(364309..364311,364324..364326,364444..364446,
FT                   364570..364572)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Acfer_0310"
FT   misc_feature    order(364441..364443,364567..364569,364579..364581)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="Acfer_0310"
FT   gene            364647..365585
FT                   /db_xref="GeneID:8736756"
FT                   /locus_tag="Acfer_0311"
FT   CDS_pept        364647..365585
FT                   /locus_tag="Acfer_0311"
FT                   /gene_family="HOG000261177" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /codon_start="1"
FT                   /EC_number="2.1.2.9"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_2244 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="GI:284047693"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="GeneID:8736756"
FT                   /translation="MKIVFMGTPEFAAASLKALVESGNCEIAAVVTQPDRPKGRGHKVM
FT                   MSAVKEYALTQDLPVLQPQRVKTPEFQAEMEKIQPDLIVVAAFGQFLPKELLDLPRYGC
FT                   INVHASLLPRYRGAAPIHYAILKGEKEAGVTIMQMDVGMDTGAMLSRTAVPVGPEMTQG
FT                   ELHDILKEKGARLLLDTIPRIVAGTVQPVPQPEEEATYASLITRDMERADWNKKAEDLH
FT                   NQFRAFDPWPGSFTLLPDGKRLKIWKSRILAGEGSQGAPGTVLQADSRGFRVACGQGSL
FT                   EILECQPEGKKRMPAASFVNGGHVKPGDRLE"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /protein_id="YP_003398032.1"
FT   misc_feature    364647..365579
FT                   /note="methionyl-tRNA formyltransferase; Reviewed; Region:
FT                   fmt; PRK00005"
FT                   /db_xref="CDD:166712"
FT                   /locus_tag="Acfer_0311"
FT   misc_feature    364647..365189
FT                   /note="Formyl transferase; Region: Formyl_trans_N; cl00395"
FT                   /db_xref="CDD:174172"
FT                   /locus_tag="Acfer_0311"
FT   misc_feature    365259..365552
FT                   /note="Formyl transferase, C-terminal domain; Region:
FT                   Formyl_trans_C; pfam02911"
FT                   /db_xref="CDD:145851"
FT                   /locus_tag="Acfer_0311"
FT   gene            365590..366363
FT                   /db_xref="GeneID:8736757"
FT                   /locus_tag="Acfer_0312"
FT   CDS_pept        365590..366363
FT                   /locus_tag="Acfer_0312"
FT                   /gene_family="HOG000010238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01976"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF116"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF116; KEGG:
FT                   gbm:Gbem_0636 protein of unknown function DUF116"
FT                   /db_xref="GI:284047694"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="GeneID:8736757"
FT                   /translation="MNMGIRPKKRLFMALASLAVLLAGAAAYGLWQLLVPGLSQIHPWL
FT                   PQVVGWAVLLLILSLLSGVVGIVLAILGFPTIRVFYFWAWHIINFLYPLSLFLGKLMGI
FT                   SKRRVEQSFIEVSNHLVRNQHVRVPANRLLILTPHCIQLDTCPYKVTRDITNCHQCGRC
FT                   GVGQLLALSKKYGVHVAIATGGTLARQAVKKARPKAILAVACERDLTSGIQDVFPLPVI
FT                   GVLNERPNGPCFNTRADMGKIEEAIRSFILEEDGQ"
FT                   /protein_id="YP_003398033.1"
FT   misc_feature    365860..366333
FT                   /note="Protein of unknown function DUF116; Region: DUF116;
FT                   cl00800"
FT                   /db_xref="CDD:154005"
FT                   /locus_tag="Acfer_0312"
FT   gene            366360..367700
FT                   /db_xref="GeneID:8736758"
FT                   /locus_tag="Acfer_0313"
FT   CDS_pept        366360..367700
FT                   /locus_tag="Acfer_0313"
FT                   /gene_family="HOG000037300" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /codon_start="1"
FT                   /product="sun protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: drm:Dred_1707 sun protein"
FT                   /db_xref="GI:284047695"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="GeneID:8736758"
FT                   /translation="MKGTAKNPREAALLILEQIFLRGAYANLALDQGLRGATLSPLDRK
FT                   LTTELVYGTVKTMGTLDWYLSRVVNRPLRKLDPLVLVILRLGAYQLLYLDRIPASAACN
FT                   ESVKLAKKWVHEGAGKLVNGALRQLARTRDQWKFPQGPDHELERIALEYYHPEWLVRRW
FT                   KFRYGLEEAVKLCAFDNARPAFSFRVNTLRDTREGLQEKLAEKGIRTRPSQWSPDGLLC
FT                   DSLPSLDDLVEGFGPDIYIQDESSMLDAAVLDPQPGERVLDLCSAPGGKTTHLAQKMQD
FT                   QGEILALDLYDHKLDLVRENARRLGIHCIRTEKQDGTVFVPEWENTAHRVLVDAPCSGL
FT                   GVLNRRAEARWTKEERSLSQFPPLQKKILANGARYVMPGGRLLYSTCTLEQDENTRVRK
FT                   WFLENHPEFAPAAFPHPLTGEPVEELQILPQRDGINGFYLCLFEKRK"
FT                   /protein_id="YP_003398034.1"
FT   misc_feature    366375..366752
FT                   /note="RNA binding domain of NusB (N protein-Utilization
FT                   Substance B) and Sun (also known as RrmB or Fmu) proteins.
FT                   This family includes two orthologous groups exemplified by
FT                   the transcription termination factor NusB and the
FT                   N-terminal domain of the rRNA-...; Region: NusB_Sun;
FT                   cl00223"
FT                   /db_xref="CDD:174045"
FT                   /locus_tag="Acfer_0313"
FT   misc_feature    366378..366386
FT                   /note="putative RNA binding site; other site"
FT                   /db_xref="CDD:29564"
FT                   /locus_tag="Acfer_0313"
FT   misc_feature    366384..367694
FT                   /note="ribosomal RNA small subunit methyltransferase RsmB;
FT                   Region: rsmB; TIGR00563"
FT                   /db_xref="CDD:161931"
FT                   /locus_tag="Acfer_0313"
FT   misc_feature    366921..367691
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Acfer_0313"
FT   gene            367709..368770
FT                   /db_xref="GeneID:8736759"
FT                   /locus_tag="Acfer_0314"
FT   CDS_pept        367709..368770
FT                   /locus_tag="Acfer_0314"
FT                   /gene_family="HOG000217991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00048"
FT                   /codon_start="1"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: radical SAM enzyme, Cfr family; PFAM:
FT                   Radical SAM domain protein; KEGG: afl:Aflv_1788 predicted
FT                   Fe-S-cluster redox enzyme"
FT                   /db_xref="GI:284047696"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:8736759"
FT                   /translation="MCKKEIMGLTLEELQTELAGLGMKKFRAEQVFRWLYEKAATDFSQ
FT                   MSNLSKDARQQLADRYTIATAQVKVLKEYRSRDGLTHKVLLELTDGATVETVLMHHDYG
FT                   YSVCLSSQVGCAMNCAFCASGLHGFVRNLTAAEILAQLYFFQSGLQPGGERVSRIVVMG
FT                   SGEPMLNLDNVLKALDILHSDRGQCIGYRNMTVSTCGVVPGIQELTAQGRNINLAISLH
FT                   GASQELRNRLMPINRKYPFPEVIQAADAYEKSNGRQVMYEYILLAGINDRPEDARNLAD
FT                   ALEHKECVINLIPANPVPEKGFERPSDRAVDRFFQMLKKRRLNVTVRKEMGKDINAACG
FT                   QLRASALKEAQNQ"
FT                   /protein_id="YP_003398035.1"
FT   misc_feature    367715..368755
FT                   /note="Predicted Fe-S-cluster redox enzyme [General
FT                   function prediction only]; Region: COG0820"
FT                   /db_xref="CDD:31162"
FT                   /locus_tag="Acfer_0314"
FT   misc_feature    367715..368755
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="Acfer_0314"
FT   gene            368767..369498
FT                   /db_xref="GeneID:8736760"
FT                   /locus_tag="Acfer_0315"
FT   CDS_pept        368767..369498
FT                   /locus_tag="Acfer_0315"
FT                   /gene_family="HOG000235782" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.16"
FT                   /transl_table="11"
FT                   /note="KEGG: ele:Elen_3041 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="GI:284047697"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="GeneID:8736760"
FT                   /translation="MIAVSRTNRGMVRPNNEDSILVREPDLYAIADGMGGADAGEVASY
FT                   EAVHQLSRLDLKGLQRKEILPFLERSIQNINKKIWELSREKENFTGMGTTLTAVYLPSP
FT                   HSAFVAHVGDSRIYVWQDGVLRQVTSDHSYVAELVRQKQMTQEEAETSSQKHMITRAIG
FT                   VDPQVQVDTFEILLDGAQKLLVCSDGLTNMISEAEIERTLGDRNLERLADGLMNGAMTA
FT                   GGDDNISFIVIDLEAAEWKVE"
FT                   /product="protein serine/threonine phosphatase"
FT                   /protein_id="YP_003398036.1"
FT   misc_feature    368776..369471
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cd00143"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Acfer_0315"
FT   misc_feature    order(368803..368805,368815..368820,368860..368868,
FT                   369328..369330,369442..369444)
FT                   /note="active site"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Acfer_0315"
FT   gene            369483..371456
FT                   /db_xref="GeneID:8736761"
FT                   /locus_tag="Acfer_0316"
FT   CDS_pept        369483..371456
FT                   /locus_tag="Acfer_0316"
FT                   /gene_family="HOG000037185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine- protein kinase, subgroup,
FT                   catalytic domain; PASTA domain containing protein; KEGG:
FT                   ate:Athe_1045 serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /db_xref="GI:284047698"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="GeneID:8736761"
FT                   /translation="MEGRITLNGRYEIIDKIGGGGMAEVFHGYDTVLHRDVGIKILRDQ
FT                   FIQDKQFVARFRQEACNAACLSHPNIVNIYDSGNENEIYYIVMEYVVGRSLKEVIQENG
FT                   ALDYKTAVRYAIGIASALKQAHDHSIVHCDVKSQNILIDTKGVPKITDFGIARAFGQPS
FT                   NASEKNVIGSVYYLSPEQAAGQPVTPQSDLYSLGVVLFEMLTGKLPYDGDTPLEVARMH
FT                   LESSTPSARRYDPDIPYYLDNIITKALAKNPRLRYATADDFLTDLKHAQTHLLGDLGGD
FT                   EDAWSNPRKHPVSDETMVISKSDMLDGILKPQRAEAAEKRPEAQTEKPQKDGEDSAGGL
FT                   LEKYGKKKLLAFFMAAIVLLSGIIYAILSYTSGDVTVPDLKGKTIVEAEAILTRDKLGY
FT                   TLTEEYDSKATPGVIIKQNPAAHSRVKAGRKIHLVVSKGPEPGVVPDLKKKTLAEATTM
FT                   LEKARLKVGNVTVKYEAGAPKGSVLSQSIAPKQKVSEGTSVDLVVNISGNQTVVPDLSG
FT                   LSLAEARNQLSSVGLTIGSIQAQESDKAKDTVLSSDPGSGSVIDRGGAVSLVVSAGKKE
FT                   EKKSRSSSGSSGGSSRTIGYTVPGSGSAKNVKIIVSDENSTRTIFSDSVAPGTRITRTV
FT                   TVGSGASVQIYVNGELAEDKAL"
FT                   /protein_id="YP_003398037.1"
FT   misc_feature    369531..370091
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    order(369531..369545,369555..369557,369594..369596,
FT                   369600..369602,369696..369698,369744..369755,
FT                   369765..369767,369771..369773,369882..369884,
FT                   369888..369890,369894..369899,369903..369905,
FT                   369936..369938,369945..369947,369996..370007)
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    order(369531..369545,369555..369557,369594..369596,
FT                   369600..369602,369696..369698,369744..369755,
FT                   369765..369767,369882..369884,369888..369890,
FT                   369894..369899,369903..369905,369936..369938)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    369543..370280
FT                   /note="Serine/Threonine protein kinases, catalytic domain;
FT                   Region: S_TKc; smart00220"
FT                   /db_xref="CDD:128516"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    order(369543..369545,369765..369767,369771..369773,
FT                   369882..369884,369888..369890,369894..369896,
FT                   369945..369947,369996..370007)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    order(369933..369953,369996..370007)
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    370608..370790
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    370809..370994
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    371007..>371393
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG2815"
FT                   /db_xref="CDD:32644"
FT                   /locus_tag="Acfer_0316"
FT   misc_feature    371013..371195
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Acfer_0316"
FT   gene            371453..372340
FT                   /db_xref="GeneID:8736762"
FT                   /locus_tag="Acfer_0317"
FT   CDS_pept        371453..372340
FT                   /locus_tag="Acfer_0317"
FT                   /gene_family="HOG000006958" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /codon_start="1"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: pjd:Pjdr2_3749 ribosome small
FT                   subunit- dependent GTPase A"
FT                   /db_xref="GI:284047699"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="GeneID:8736762"
FT                   /translation="MSTATGRIIKTYNGYYYVAGDDGVLYTCKVKGRMKQKRFIMAAGD
FT                   RVELEAQGAEGMIRQVLPRQNLLQRPLVANLDCLMAVFACGDPDPSFLLVDKLLALAEA
FT                   AGIPAALVLNKRDLAPAGLIDRFRSIYEPLGYPVLPVEAREGLGLEPILERVKGHTVAF
FT                   GGPSGAGKSTLLNHLDPSLTLKTGHVSSKIGRGRHTTRFAELLPFAGGYIVDTPGFGNI
FT                   DLSELQMDQAADGFREIRKQEGLCRFTGCTHTHEPDCEVKAAVERGEIAPSRYASYCTI
FT                   RQELADPKKRGKKS"
FT                   /protein_id="YP_003398038.1"
FT   misc_feature    371462..372325
FT                   /note="ribosome-associated GTPase; Reviewed; Region:
FT                   PRK00098"
FT                   /db_xref="CDD:166784"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    371468..372301
FT                   /note="YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis)
FT                   represents a protein family whose members are broadly
FT                   conserved in bacteria and have been shown to be essential
FT                   to the growth of E. coli and B. subtilis. Proteins of the
FT                   YjeQ family contain all sequence...; Region: YjeQ_engC;
FT                   cd01854"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    order(371477..371479,371483..371485,371579..371590,
FT                   371651..371653,371672..371677,372056..372058,
FT                   372062..372067,372071..372073)
FT                   /note="GTPase/OB domain interface; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    order(371726..371731,371738..371743,371747..371752,
FT                   371759..371764,371858..371860,372143..372145,
FT                   372155..372157,372161..372163,372272..372274,
FT                   372281..372283,372293..372295)
FT                   /note="GTPase/Zn-binding domain interface; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    order(371792..371797,371801..371806,371876..371881,
FT                   371954..371971)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    371792..371803
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    371876..371884
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    371945..371968
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    372041..372064
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    372050..372052
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    372095..372106
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   misc_feature    372101..372109
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:57925"
FT                   /locus_tag="Acfer_0317"
FT   gene            372337..372978
FT                   /db_xref="GeneID:8736763"
FT                   /locus_tag="Acfer_0318"
FT   CDS_pept        372337..372978
FT                   /locus_tag="Acfer_0318"
FT                   /gene_family="HOG000259348" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /codon_start="1"
FT                   /EC_number="5.1.3.1"
FT                   /transl_table="11"
FT                   /note="KEGG: sat:SYN_01763 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="GI:284047700"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8736763"
FT                   /translation="MTIIAPSILSSDFSRLGEEVARIQDAGADWCHIDVMDGQFVPNLT
FT                   FGAPVVKSLRKRTEMFFDCHLMVENPENYVDSFAAAGADLICVHAEATHHLHRLLQSIH
FT                   SKGIQAGVALNPATPLCQIEEILPYADMILIMSVNPGFGGQKFIPTSVDKIRRLKQMIR
FT                   ERDLKTLIEVDGGVNGETAKACREAGADVLVAGSFVFGAADMQEAVAALR"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /protein_id="YP_003398039.1"
FT   misc_feature    372343..372975
FT                   /note="Ribulose-5-phosphate 3-epimerase (RPE). This enzyme
FT                   catalyses the interconversion of D-ribulose 5-phosphate
FT                   (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin
FT                   cycle (reductive pentose phosphate pathway) in chloroplasts
FT                   and in the oxidative...; Region: RPE; cd00429"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="Acfer_0318"
FT   misc_feature    order(372355..372357,372361..372363,372436..372438,
FT                   372535..372537,372754..372759,372763..372768,
FT                   372856..372858,372862..372864,372922..372927)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="Acfer_0318"
FT   misc_feature    order(372376..372378,372385..372387,372445..372447,
FT                   372451..372456,372460..372462,372466..372477,
FT                   372544..372546,372556..372558,372619..372621,
FT                   372625..372630,372682..372684,372691..372693,
FT                   372697..372699,372709..372711,372751..372753,
FT                   372778..372780,372784..372786,372796..372798)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="Acfer_0318"
FT   misc_feature    order(372430..372432,372436..372438,372529..372531,
FT                   372856..372858)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:73366"
FT                   /locus_tag="Acfer_0318"
FT   gene            372983..374302
FT                   /db_xref="GeneID:8736764"
FT                   /locus_tag="Acfer_0319"
FT   CDS_pept        372983..374302
FT                   /locus_tag="Acfer_0319"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047701"
FT                   /db_xref="GeneID:8736764"
FT                   /translation="MKAFLQKHRRKIKWILLCVLASFLVLAWLAYIASIHAAQIFNREM
FT                   ARQHFFDGTITVERLTATPLGHVRFENLEWKGSHDGNRVFIPRGSFQVKPMDIVLRKIS
FT                   TRTIQELELNEAEIDLTFTEHMHIRGIQAAELSQPAARKGKKKFDIKLKNVDARVKLNH
FT                   CRMTARYRQRIHTFQDVNADLRYNSNDRLTIDFSTGELGGTLEGKGVDIQGSVDLKPPV
FT                   STYDLKLGIKELNPSSLGTGLNIRERVTASATVTGELPKPVIVGELYMPNLNLPGLKFT
FT                   EVKGNFKYEDGYIDAQNVTADIFEGNCDARGGFNIDTKAYTVSVMGHDLHSEDATNIPY
FT                   FRTLVQLDLKMLCDGDNRSTLTYGSFYSGKGIYAIIKFNSIKGTFSNQYKQLKFSDVEI
FT                   KSDGGDIVAPQFELVDGKLQMGNLYYVAPGGARARIHFFG"
FT                   /protein_id="YP_003398040.1"
FT   gene            374357..375313
FT                   /db_xref="GeneID:8736765"
FT                   /locus_tag="Acfer_0320"
FT   CDS_pept        374357..375313
FT                   /locus_tag="Acfer_0320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   cce:Ccel_3204 periplasmic binding protein"
FT                   /db_xref="GI:284047702"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="GeneID:8736765"
FT                   /translation="MKLLRILGILFLLLSAGCGPAAPEQGGYTVTDVRGKTVHLPRPPR
FT                   KILTDSLHLDETLLTLVPADHLAGACYLDRESGISFIAEETRSVEPVLREVTPETVAGT
FT                   KPDLFLASTWSDPGLIQKVEELGIPVVVCRGPVTLEEIRENVRLMARALDRETVGEKVL
FT                   ARMDDQLERTEKTLAALKEPEPVGMLVSLMSRYGGGGSLYDDLCRRAHVGNGLSRAGLQ
FT                   NGQPLTREAILQADPDFFLISLPYGEEKADYEKFQQQFFADPALQGLKGYDRRVALPDR
FT                   YVYDASPMAVYGIQALANGAYGRPLFPLEREPLLKGY"
FT                   /protein_id="YP_003398041.1"
FT   misc_feature    374438..375250
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="Acfer_0320"
FT   misc_feature    order(374717..374722,374729..374731,374807..374809)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="Acfer_0320"
FT   gene            375315..376142
FT                   /db_xref="GeneID:8736766"
FT                   /locus_tag="Acfer_0321"
FT   CDS_pept        375315..376142
FT                   /locus_tag="Acfer_0321"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nph:NP3818A corrinoid ABC transporter ATPase"
FT                   /db_xref="GI:284047703"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736766"
FT                   /translation="MELTMAKGKVGYGGKTVLENLDLCLKPGDCLGLVGPNGAGKSTML
FT                   RTLAGILPLQAGALTLGDRPLGEWNRREWSRQVSYLPQERELPFGYTAESTVLMGRYPY
FT                   LGWQQQEGSREKAQARACLGLFGLEKMAARPVTELSGGQRQRVLLARILIQQTPVVLLD
FT                   EPTAELDLVYENTVLGLSRQLARAGRSVVLSLHDIGQAARYCTRLVLLGQGGMLAQGSP
FT                   RDVLTEERLEAAYGVPFLVREQEGELTVRVRQDPDREAREEKWLEQILENREA"
FT                   /protein_id="YP_003398042.1"
FT   misc_feature    375315..376052
FT                   /note="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components [Inorganic ion transport and
FT                   metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
FT                   /db_xref="CDD:31317"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375342..375974
FT                   /note="ABC transporters, involved in the uptake of
FT                   siderophores, heme, and vitamin B12, are widely conserved
FT                   in bacteria and archaea.  Only very few species lack
FT                   representatives of the siderophore family transporters. The
FT                   E. coli BtuCD protein is an ABC...; Region:
FT                   ABC_Iron-Siderophores_B12_Hemin; cd03214"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375417..375440
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    order(375426..375431,375435..375443,375561..375563,
FT                   375801..375806,375900..375902)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375552..375563
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375729..375758
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375789..375806
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375813..375824
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   misc_feature    375888..375908
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="Acfer_0321"
FT   gene            376147..376785
FT                   /db_xref="GeneID:8736767"
FT                   /locus_tag="Acfer_0322"
FT   CDS_pept        376147..376785
FT                   /locus_tag="Acfer_0322"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /codon_start="1"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /transl_table="11"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   ote:Oter_2347 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="GI:284047704"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="GeneID:8736767"
FT                   /translation="MIGWLEYGWMYFLRGGVVMWPLLLCSLVSLTLILERGAFFRREDS
FT                   GRDYPRTFCRMVRQKQWQDLLAMSRRTRGAQAELGIRLLTAPPEAREKESYILGESQQL
FT                   VSRFDKGLNYLSVIVTLAPILGLLGTITGMMSSFQALGDRWDNPLGVTAGVAEAMITTV
FT                   FGLLIAIGTICFHTYFSQRVNTVLEEVEQMDNAFMENAGDMPREGGKRV"
FT                   /protein_id="YP_003398043.1"
FT   misc_feature    376180..376743
FT                   /note="Biopolymer transport proteins [Intracellular
FT                   trafficking and secretion]; Region: TolQ; COG0811"
FT                   /db_xref="CDD:31153"
FT                   /locus_tag="Acfer_0322"
FT   misc_feature    <376450..376725
FT                   /note="MotA/TolQ/ExbB proton channel family; Region:
FT                   MotA_ExbB; cl00568"
FT                   /db_xref="CDD:174290"
FT                   /locus_tag="Acfer_0322"
FT   gene            376782..377198
FT                   /db_xref="GeneID:8736768"
FT                   /locus_tag="Acfer_0323"
FT   CDS_pept        376782..377198
FT                   /locus_tag="Acfer_0323"
FT                   /gene_family="HOG000134906" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /codon_start="1"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /transl_table="11"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   mno:Mnod_1396 protein TolR"
FT                   /db_xref="GI:284047705"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="GeneID:8736768"
FT                   /translation="MIHLHRSGGEKHPSIQISPMIDMVFLLLIFFIVCTMYMTQQKGVP
FT                   VELPAGRGQLQQKAQVEVTLPRDGTIWYQDHPVTVEELVREAAAAARENPHQTINLRAD
FT                   KEVSYGRVMGIMGELKRAGLEEFSLSVSTGEAHG"
FT                   /protein_id="YP_003398044.1"
FT   misc_feature    376809..377183
FT                   /note="Biopolymer transport protein ExbD/TolR; Region:
FT                   ExbD; cl00537"
FT                   /db_xref="CDD:174272"
FT                   /locus_tag="Acfer_0323"
FT   gene            377191..377961
FT                   /db_xref="GeneID:8736769"
FT                   /locus_tag="Acfer_0324"
FT   CDS_pept        377191..377961
FT                   /locus_tag="Acfer_0324"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: pca:Pcar_0453
FT                   TonB-like protein"
FT                   /db_xref="GI:284047706"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:8736769"
FT                   /translation="MAKPEWNRYFSLSLLAHLLILSLGGALLYAHRSLPETPQESIRVH
FT                   LAGPDRGRGNAGTPGKGKDSAAQQGNGTAHAGTGEQDRLLEQLMEAPSRVNDRGEVERP
FT                   ERNGAQESGGEQAGVSPSSGGSGETGGSGNLAGNGQGNGSGGPGAGDGSGASQGGGESL
FT                   EDRSRDASLESYSKIYPQAARASGEEGTAQVGVEISAGGEVLSAWLESSTGYDRLDRAA
FT                   LKSARQWTFSPALDAAGHPVPSRKSVTVVYFLTE"
FT                   /protein_id="YP_003398045.1"
FT   misc_feature    377719..377946
FT                   /note="Gram-negative bacterial tonB protein; Region: TonB;
FT                   cl10048"
FT                   /db_xref="CDD:175073"
FT                   /locus_tag="Acfer_0324"
FT   gene            378044..378787
FT                   /db_xref="GeneID:8736770"
FT                   /locus_tag="Acfer_0325"
FT   CDS_pept        378044..378787
FT                   /locus_tag="Acfer_0325"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bay:RBAM_036150 hypothetical protein"
FT                   /db_xref="GI:284047707"
FT                   /db_xref="GeneID:8736770"
FT                   /translation="MVQKKIRTLACSTLLAGLWMLMGAGAAQAQPATASEAAHHVIEQE
FT                   LQSHVPGQAVYARNGVVIRSGILGEKDLLIHYPQVRVMGNPQASRKISRYFAKQANLSR
FT                   ENYNKANTMEEKLTSRVDFQVSYHGNRYLSFQTYGYDYVERAAHPTSWELGKTFDLTTG
FT                   ERVPWQKVIRQDLRDQFTLKKINEALWNTEYGKGHYFFQDFKGLEKLPENYYLDEKGHV
FT                   HFVFGQYEIAPYAVGIIDLNMGLGV"
FT                   /protein_id="YP_003398046.1"
FT   misc_feature    378431..378766
FT                   /note="Protein of unknown function (DUF3298); Region:
FT                   DUF3298; pfam11738"
FT                   /db_xref="CDD:152174"
FT                   /locus_tag="Acfer_0325"
FT   gene            378914..379996
FT                   /db_xref="GeneID:8736771"
FT                   /locus_tag="Acfer_0326"
FT   CDS_pept        378914..379996
FT                   /locus_tag="Acfer_0326"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /codon_start="1"
FT                   /product="peptidase M48 Ste24p"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: bpe:BP1463
FT                   putative lipoprotein"
FT                   /db_xref="GI:284047708"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="GeneID:8736771"
FT                   /translation="MKLWKKELMGCALAGLVGLGTAFGAVPASQAEAGGVLVDVLGTAI
FT                   AGTMYRDKVMGVYKTYNNTDKGRQEWFEHMKEEEGVVDNEYLNSRLDTIMANVTAGIGA
FT                   VDPTVYKKPYHYFISPHDDANAYCTIGHNVNVYKGIFNLFPTDDEIAVVIGHELGHGQK
FT                   DHPIQGVKKSLNAAVLAEMANAATGGIASGAIGQLYTYTRNVHLSKPMEWEADNLAFDY
FT                   ITHTNYNPGATAAVWQRFLEKYGNMNVHWSDHPTCTERRENYVKKLNAWSNKHVDDKDG
FT                   VVYVNKKEFITPSATGSMSSKERSYFVMGNLAAVYHNNKTAPEAYANGDTVMMGEQPIM
FT                   TSTGDDPTAEELAAKLNRIK"
FT                   /protein_id="YP_003398047.1"
FT   misc_feature    <379241..379633
FT                   /note="Peptidase family M48; Region: Peptidase_M48;
FT                   cl12018"
FT                   /db_xref="CDD:175383"
FT                   /locus_tag="Acfer_0326"
FT   gene            380488..382032
FT                   /db_xref="GeneID:8736772"
FT                   /locus_tag="Acfer_R0016"
FT   rRNA            380488..382032
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736772"
FT                   /locus_tag="Acfer_R0016"
FT                   /product="16S ribosomal RNA"
FT   gene            382301..385204
FT                   /db_xref="GeneID:8736773"
FT                   /locus_tag="Acfer_R0017"
FT   rRNA            382301..385204
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736773"
FT                   /locus_tag="Acfer_R0017"
FT                   /product="23S ribosomal RNA"
FT   gene            385436..385551
FT                   /db_xref="GeneID:8736774"
FT                   /locus_tag="Acfer_R0018"
FT   rRNA            385436..385551
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:8736774"
FT                   /locus_tag="Acfer_R0018"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(385813..386838)
FT                   /db_xref="GeneID:8736775"
FT                   /locus_tag="Acfer_0327"
FT   CDS_pept        complement(385813..386838)
FT                   /locus_tag="Acfer_0327"
FT                   /gene_family="HOG000112303" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00832"
FT                   /codon_start="1"
FT                   /product="arsenical-resistance protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter; KEGG: blj:BLD_1095 arsenite efflux
FT                   pump"
FT                   /db_xref="GI:284047709"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="GeneID:8736775"
FT                   /translation="MSSEKNSGISPFQRYLSLWVFLCMVAGVLVGHFLPAVPRFLDRLQ
FT                   IDGISIPIAILIWIMIYPMMMKVDFQSIREVGRHPKGLFVTWITNWLIKPFTMYALAAF
FT                   FFFHVFQAFIPQDLATQYLAGAVVLGAAPCTAMVFVWSTLTKGDPAYTVVQVATNDLII
FT                   LAAFVPIVKFLLGVSHVTVPYSVLFLSIFLFVVIPLAGGILTRMTVIRQKGEAYFNQVF
FT                   IHKFDQATTWGLLLTLVIIFSSQAQVILSNPFHILLIAIPLVLQTYLIFAIAYEASNLL
FT                   HLPHNIAAPAGMIGASNFFELAVAVAIALFGVTSPAALATTVGVLTEVPVMLSLVKIAN
FT                   K"
FT                   /protein_id="YP_003398048.1"
FT   misc_feature    complement(385822..386814)
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Acfer_0327"
FT   gene            complement(386907..387227)
FT                   /db_xref="GeneID:8736776"
FT                   /locus_tag="Acfer_0328"
FT   CDS_pept        complement(386907..387227)
FT                   /locus_tag="Acfer_0328"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: blj:BLD_1091 arsenical resistance
FT                   operon repressor"
FT                   /db_xref="GI:284047710"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8736776"
FT                   /translation="MKNLGGTARLFKALADENRLHILELLQRGERCACVLLENLHLSQP
FT                   TLSHHMKILCDAGFVTGRKEGKWVYYTLNHQAAGELEALLQELFQEKTAAEPDDCQCSR
FT                   CR"
FT                   /protein_id="YP_003398049.1"
FT   misc_feature    complement(387003..387197)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Acfer_0328"
FT   misc_feature    complement(order(387054..387056,387144..387146,
FT                   387153..387158,387165..387170,387177..387179,
FT                   387186..387188,387192..387197))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Acfer_0328"
FT   misc_feature    complement(order(387015..387023,387036..387044,
FT                   387060..387065,387069..387074,387081..387086,
FT                   387090..387101,387126..387134,387171..387179,
FT                   387189..387194))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Acfer_0328"
FT   misc_feature    complement(order(387123..387125,387132..387134))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Acfer_0328"
FT   gene            387436..388773
FT                   /db_xref="GeneID:8736777"
FT                   /locus_tag="Acfer_0329"
FT   CDS_pept        387436..388773
FT                   /locus_tag="Acfer_0329"
FT                   /gene_family="HOG000097664" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mta:Moth_1160
FT                   metallophosphoesterase"
FT                   /db_xref="GI:284047711"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="GeneID:8736777"
FT                   /translation="MKRNVSIKNSRILVGILVLLGAVLAGTWRFSPWFRTWAMGKAEQA
FT                   RGAAIHYDLLDEVEARNIRQVMTADPAHSRVIMWQSDYAVKEPVLEYRMEGKENGETVP
FT                   VQAEKFTDGGKNTWIYRARISGLEPGQTYGYRIRDGKKATAWMSLKAFAGNTFKALVFP
FT                   DSQSADYSAWKATAQPAWQRNQDAQFFVNMGDQVDNGQDASQWNAWFDVVEPMAEKIPM
FT                   ATTVGNHETYDLNWKVRRPEAYMKLFNLPQNGYAQYPNRFYSFTVGDVHFVVLDTVFSE
FT                   MKDLEPNLEQDEIQWFRKDMEQNRQKWNIVVMHKDPLRYAFNPATGRTGRDEGIEQEGK
FT                   VWMPLFDEYGIDLVLSAHLHTYRNRGHIRDFRHNPDGPLYILTGVAGDVRYPGLWKQHP
FT                   LDEYVAPQPETDNYLVMTKTDDELQLQAFLPDGTLLDTATMEKKAQ"
FT                   /protein_id="YP_003398050.1"
FT   misc_feature    387898..388665
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Acfer_0329"
FT   misc_feature    387904..388521
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="Acfer_0329"
FT   misc_feature    order(387925..387927,387931..387933,388018..388020,
FT                   388117..388122,388375..388377,388507..388509)
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Acfer_0329"
FT   misc_feature    order(387925..387927,387931..387933,388018..388020,
FT                   388117..388119,388375..388377,388507..388509)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Acfer_0329"
FT   gene            388801..389121
FT                   /db_xref="GeneID:8736778"
FT                   /locus_tag="Acfer_0330"
FT   CDS_pept        388801..389121
FT                   /locus_tag="Acfer_0330"
FT                   /gene_family="HOG000293547" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: cbt:CLH_2468
FT                   transcriptional regulator, HxlR family"
FT                   /db_xref="GI:284047712"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:8736778"
FT                   /translation="MIHFDGKTYDCPFDCFLAVLKGKWRTDLLLALSAHPCHFRELQRT
FT                   LPGISAKVLTENLRILERNHLMERREQDVPSGMVEYRLSPEGKQLVQVMEQINQWVERC
FT                   LG"
FT                   /protein_id="YP_003398051.1"
FT   misc_feature    388801..389109
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Acfer_0330"
FT   gene            complement(389161..389616)
FT                   /db_xref="GeneID:8736779"
FT                   /locus_tag="Acfer_0331"
FT   CDS_pept        complement(389161..389616)
FT                   /locus_tag="Acfer_0331"
FT                   /gene_family="HOG000208328" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1486"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   ccv:CCV52592_0353 putative pyruvate kinase"
FT                   /db_xref="GI:284047713"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="GeneID:8736779"
FT                   /translation="MLKKKLLTLSLGLLLCGMLPGVAGAAPHFKNNKELAAYFWNQIFN
FT                   EHHPEVIDQLTDDHYIQHNPGFNDGKQAFKDGITGFLKEFPESTAEIKHMGADGDLVFI
FT                   HNHIKLNAQDRGQAAVDIFRIKKGKIVEHWDVIQDIPEKTENNNTMF"
FT                   /protein_id="YP_003398052.1"
FT   misc_feature    complement(389164..389538)
FT                   /note="Nuclear transport factor 2 (NTF2-like) superfamily.
FT                   This family includes members of the NTF2 family,
FT                   Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
FT                   and the beta subunit of Ring hydroxylating dioxygenases.
FT                   This family is a classic example of...; Region: NTF2_like;
FT                   cl09109"
FT                   /db_xref="CDD:175003"
FT                   /locus_tag="Acfer_0331"
FT   gene            389763..390653
FT                   /db_xref="GeneID:8736780"
FT                   /locus_tag="Acfer_0332"
FT   CDS_pept        389763..390653
FT                   /locus_tag="Acfer_0332"
FT                   /gene_family="HOG000220466" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /codon_start="1"
FT                   /EC_number="5.1.1.7"
FT                   /transl_table="11"
FT                   /note="KEGG: mmp:MMP0917 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="GI:284047714"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="GeneID:8736780"
FT                   /translation="MKMKFTKMHGCGNDYVYVDCMDRMLPNPGKISEFVSRRRFGIGSD
FT                   GLICICPSDKADFRMRMFNADASEGKMCGNGSRCIAKYVYDKGLTRKDTITLETLGGIK
FT                   TIHMTVEQGKVVLAEVDMGQAVVRTADVPMDWPEETCVDQPVVFAGPDGKGFTVRGTAV
FT                   SMGNPHFVTFVEDVETAPVEAVGRIIETSPVFPERTNVEFVQIVDENHVKFRVWERGSG
FT                   ETWACGTGACAVGYTCVTLGKAGKRGEFLKVEAKGGMLQVRTGEGDAMTLKGPATTVYE
FT                   GEIELPEELLEESLK"
FT                   /product="diaminopimelate epimerase"
FT                   /protein_id="YP_003398053.1"
FT   misc_feature    389763..390602
FT                   /note="diaminopimelate epimerase; Provisional; Region:
FT                   dapF; PRK00450"
FT                   /db_xref="CDD:166970"
FT                   /locus_tag="Acfer_0332"
FT   misc_feature    389775..390140
FT                   /note="Diaminopimelate epimerase; Region: DAP_epimerase;
FT                   pfam01678"
FT                   /db_xref="CDD:145037"
FT                   /locus_tag="Acfer_0332"
FT   misc_feature    390243..390599
FT                   /note="Diaminopimelate epimerase; Region: DAP_epimerase;
FT                   pfam01678"
FT                   /db_xref="CDD:145037"
FT                   /locus_tag="Acfer_0332"
FT   gene            390736..391935
FT                   /db_xref="GeneID:8736781"
FT                   /locus_tag="Acfer_0333"
FT   CDS_pept        390736..391935
FT                   /locus_tag="Acfer_0333"
FT                   /gene_family="HOG000223061" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03542"
FT                   /codon_start="1"
FT                   /product="LL-diaminopimelate aminotransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: LL-diaminopimelate aminotransferase; PFAM:
FT                   aminotransferase class I and II; KEGG: tel:tll2102
FT                   L,L-diaminopimelate aminotransferase"
FT                   /db_xref="GI:284047715"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="GeneID:8736781"
FT                   /translation="MALVNGNFAKLKESYLFSDIAARVKAFTEAHPDKKLIKMGIGDVT
FT                   LPLAPSVVEAMTKAVQEMGHKETFRGYGPEQGYEFLHEAIAKYYARHGVELETKEIFVS
FT                   DGAKSDCGNITDLFDDSNVILVPDPVYPVYVDTNVMRDRKILYMNGTPENDFLPMPDPA
FT                   VKADIIYLCSPNNPTGAAYNKEQLKAWVDYALKNDAIILYDAAYEAFITNPEMPRSIYT
FT                   IPGAKDCAIEFCSFSKTAGFTGTRCGYTVVPLQLTRKSPEGNEMSLNKMWLRRQTTKFN
FT                   GVNYIVQRGAEAAMSPVGEKECGDMLAYYRENARMMMETFDKKGYKYYGGVYSPYVWVK
FT                   CPNGMGSWEYFDHLLNDLAIVGTPGAGFGTMGEGYLRLSAFGTHEGTKEAMERIEKDNI
FT                   "
FT                   /protein_id="YP_003398054.1"
FT   misc_feature    390772..391932
FT                   /note="aspartate aminotransferase; Provisional; Region:
FT                   PRK07681"
FT                   /db_xref="CDD:169059"
FT                   /locus_tag="Acfer_0333"
FT   misc_feature    390844..391923
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0333"
FT   misc_feature    order(391051..391059,391126..391128,391261..391263,
FT                   391354..391356,391438..391440,391444..391449,
FT                   391471..391473)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0333"
FT   misc_feature    order(391060..391062,391156..391158,391333..391335,
FT                   391465..391473,391594..391596,391603..391605)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0333"
FT   misc_feature    391447..391449
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Acfer_0333"
FT   gene            391959..392399
FT                   /db_xref="GeneID:8736782"
FT                   /locus_tag="Acfer_0334"
FT   CDS_pept        391959..392399
FT                   /locus_tag="Acfer_0334"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047716"
FT                   /db_xref="GeneID:8736782"
FT                   /translation="MKKIIMMLTAVLSLGMASLGFASPASDLLAQEETTTTKVISLIQG
FT                   KGQLAEVSTGFSPALQKNFNAAALANMKKGVTEQLGGISNLKLVRLDKFADADRLIYIG
FT                   DAKKAPNVQMTFVFSVKGKKAELQGLNLIPVEVKQVKNNQAK"
FT                   /protein_id="YP_003398055.1"
FT   gene            complement(392442..393503)
FT                   /db_xref="GeneID:8736783"
FT                   /locus_tag="Acfer_0335"
FT   CDS_pept        complement(392442..393503)
FT                   /locus_tag="Acfer_0335"
FT                   /gene_family="HOG000263814" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: hmo:HM1_2279 spermidine/putrescine abc transporter,
FT                   spermidine/putrescine-binding protein"
FT                   /db_xref="GI:284047717"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8736783"
FT                   /translation="MKKRFWLLALCLVSLLLVLTGCGSEKKPAEDGKQVLNIFSWADNF
FT                   DPEMIKAFEKKYNCRVNYDVFANNEELLAKIQAGGAQYDLIQPSDYMVSTMIKLGMLEK
FT                   LDKDALPNTRHMMDTLQHPQFDPRGEYSVVYTWGMTGIIYNKKYVKTPPTSWNDLWDPA
FT                   YKGRVILLNDSREVFGMALKKNGWSNNSTDPDQLAKAFQDLKELAPSVLAYDTDSLKQK
FT                   FIAEEGWIGTMWSGDASFSYRENPNLGFVIPKEGTLVWADTLAIPKGAKHKALAEKFIN
FT                   FLFDPEVSAKNYEAIGYNDPNSNARKYHSKEYLEDPMLNTAITHLKEGEWLRDIGDGIT
FT                   LYDKYWTELKTIR"
FT                   /protein_id="YP_003398056.1"
FT   misc_feature    complement(392445..393419)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Acfer_0335"
FT   misc_feature    complement(392445..393404)
FT                   /note="Spermidine/putrescine-binding periplasmic protein
FT                   [Amino acid transport and metabolism]; Region: PotD;
FT                   COG0687"
FT                   /db_xref="CDD:31031"
FT                   /locus_tag="Acfer_0335"
FT   gene            complement(393510..394307)
FT                   /db_xref="GeneID:8736784"
FT                   /locus_tag="Acfer_0336"
FT   CDS_pept        complement(393510..394307)
FT                   /locus_tag="Acfer_0336"
FT                   /gene_family="HOG000263700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hmo:HM1_2278
FT                   spermidine/putrescine abc transporter, permease protein"
FT                   /db_xref="GI:284047718"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8736784"
FT                   /translation="MQKSWRNATLLAYSLAILAFLYLPLLILSLYSFNDSRINAVWTGF
FT                   TLKWYVSLLQNDRVLEALENSLLIASITTAVTTVMGTLAALALHRYQYKCKILINSLLY
FT                   LPILIPEIVMGLSLLVLFSQTGVPLGKTTLIIAHITFCISFVIITVGARLEGCRQDLEE
FT                   AASDLYATPWQAFRYVTFPMILPGVVAGALMAFTLSIDDFVISFFVAGPNSTTLPLYIY
FT                   AMVKRGISPQINALSTCMMLVTVSLVVISQLLQKKGYHSSRKD"
FT                   /protein_id="YP_003398057.1"
FT   misc_feature    complement(393558..394115)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0336"
FT   misc_feature    complement(order(393558..393560,393567..393572,
FT                   393579..393584,393588..393590,393600..393602,
FT                   393609..393614,393642..393647,393684..393689,
FT                   393696..393707,393726..393728,393735..393740,
FT                   393780..393782,393831..393833,393840..393845,
FT                   393855..393857,393861..393866,393873..393875,
FT                   393879..393881,393885..393890,393951..393953,
FT                   393957..393962,393969..393998,394002..394013,
FT                   394041..394043,394056..394061,394068..394073))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0336"
FT   misc_feature    complement(order(393690..393707,393951..393995))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0336"
FT   misc_feature    complement(order(393612..393614,393642..393644,
FT                   393651..393653,393687..393689,393903..393905,
FT                   393951..393953))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0336"
FT   misc_feature    complement(order(393759..393761,393771..393776,
FT                   393792..393830))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0336"
FT   gene            complement(394288..395148)
FT                   /db_xref="GeneID:8736785"
FT                   /locus_tag="Acfer_0337"
FT   CDS_pept        complement(394288..395148)
FT                   /locus_tag="Acfer_0337"
FT                   /gene_family="HOG000263581" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hmo:HM1_2277
FT                   spermidine/putrescine abc transporter, permease protein"
FT                   /db_xref="GI:284047719"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8736785"
FT                   /translation="MKRGKMLVLPSMVWLGLFFALPLLIVVGVSFASRTAYGQVVFHWT
FT                   LENYARFLEPLYLTIFVSTLATALITTLFTFAMGYPVAYTIAMVLPKKWQQAGIILVMI
FT                   PFWINFLIRSYSWVIILRAQGLVNTFLLHLGVIQVPMSLLYNNYAVMLGMVYALLPFMV
FT                   LPIYVSLEQMDKRLLEAASDLGAAPFTAFRKITLPLTLPGVAAGSILVFISSLGMFVVP
FT                   DIMGGAKSALMGNVIQNQFLAARDWPFGSALSIILALLSLVMIVLYYKALEAQKGGKSH
FT                   AEKLA"
FT                   /protein_id="YP_003398058.1"
FT   misc_feature    complement(394426..394860)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0337"
FT   misc_feature    complement(order(394435..394440,394477..394482,
FT                   394489..394500,394519..394521,394528..394533,
FT                   394573..394575,394624..394626,394633..394638,
FT                   394648..394650,394654..394659,394666..394668,
FT                   394672..394674,394678..394683,394756..394758,
FT                   394762..394767,394774..394788,394789..394800,
FT                   394804..394815,394843..394845,394858..394860))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0337"
FT   misc_feature    complement(order(394483..394500,394756..394788,
FT                   394789..394797))
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0337"
FT   misc_feature    complement(order(394435..394437,394444..394446,
FT                   394480..394482,394696..394698,394756..394758))
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0337"
FT   misc_feature    complement(order(394552..394554,394564..394569,
FT                   394585..394623))
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Acfer_0337"
FT   gene            complement(395145..396149)
FT                   /db_xref="GeneID:8736786"
FT                   /locus_tag="Acfer_0338"
FT   CDS_pept        complement(395145..396149)
FT                   /locus_tag="Acfer_0338"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /codon_start="1"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: hmo:HM1_2276 spermidine/putrescine abc
FT                   transporter, ATP-binding protein PotA; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:284047720"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8736786"
FT                   /translation="MKEMIRLVGITKEFEDNLIIPTLNLTIYDGEFVTLLGPSGCGKTT
FT                   MLRMIAGLETPTAGHIFLDNEDVTHLAPYKRNVNMVFQHYALFPHMTVEENIRFGLMMK
FT                   KVPRKEQQKRVAEVLQLTQLEELRYRKPQQMSGGQQQRVAIARALVNNPKVLLLDEPLG
FT                   ALDYKLRKTMQLELKNLQQRLGITFIYVTHDQEEALTMSDRVIIVNGGRIEQDDPPARI
FT                   YQYPRSRFAAGFIGENNFFPIPGDDSRLMAVRPQFINVRSLDEVPAEESRPVHTGTIEQ
FT                   IQFCGTLDKLFIRLDATRETITAYQYYDEYRKWEVDDRVAISWDAKDGVQVTK"
FT                   /protein_id="YP_003398059.1"
FT   misc_feature    complement(395178..396146)
FT                   /note="putrescine/spermidine ABC transporter ATPase
FT                   protein; Reviewed; Region: potA; PRK09452"
FT                   /db_xref="CDD:169882"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395442..396137)
FT                   /note="PotA is an ABC-type transporter and the ATPase
FT                   component of the spermidine/putrescine-preferential uptake
FT                   system consisting of PotA, -B, -C, and -D.  PotA has two
FT                   domains with the N-terminal domain containing the ATPase
FT                   activity and the residues...; Region: ABC_PotA_N; cd03300"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(396018..396041)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(order(395571..395573,395670..395675,
FT                   395901..395903,396015..396023,396027..396032))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395901..395912)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395718..395747)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395670..395687)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395652..395663)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395565..395585)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73059"
FT                   /locus_tag="Acfer_0338"
FT   misc_feature    complement(395160..395399)
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Acfer_0338"
FT   gene            396407..396718
FT                   /db_xref="GeneID:8736787"
FT                   /locus_tag="Acfer_0339"
FT   CDS_pept        396407..396718
FT                   /locus_tag="Acfer_0339"
FT                   /gene_family="HOG000036265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: sth:STH429 50S ribosomal protein L21"
FT                   /db_xref="GI:284047721"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="GeneID:8736787"
FT                   /translation="MYAIIRTGGKQYRVSEGDVLNVEKLNVEEGQEVVFDEVLTVVNDG
FT                   DVKVGAPTVAGAKVTAKVAKQGKADKIFVFKYRAKSNYRKRQGHRQPFTQVEITSIEA"
FT                   /protein_id="YP_003398060.1"
FT   misc_feature    396407..396715
FT                   /note="Ribosomal prokaryotic L21 protein; Region:
FT                   Ribosomal_L21p; cl00382"
FT                   /db_xref="CDD:174161"
FT                   /locus_tag="Acfer_0339"
FT   gene            396722..397051
FT                   /db_xref="GeneID:8736788"
FT                   /locus_tag="Acfer_0340"
FT   CDS_pept        396722..397051
FT                   /locus_tag="Acfer_0340"
FT                   /gene_family="HOG000019196" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04327"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF464"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF464; KEGG:
FT                   cpy:Cphy_2550 hypothetical protein"
FT                   /db_xref="GI:284047722"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="GeneID:8736788"
FT                   /translation="MIAVDIYYNRHGRIRRYRVSGHAEYNPEGFDEVCYAVSLNTQVAA
FT                   NGLNEVLHRKVDYSIDQEDGSLAVRLVDEPDAKTDAVLKTMVCGLRHLQKTYSQDYLMI
FT                   KEHRR"
FT                   /protein_id="YP_003398061.1"
FT   misc_feature    396722..397018
FT                   /note="Protein of unknown function (DUF464); Region:
FT                   DUF464; cl01080"
FT                   /db_xref="CDD:174517"
FT                   /locus_tag="Acfer_0340"
FT   gene            397057..397347
FT                   /db_xref="GeneID:8736789"
FT                   /locus_tag="Acfer_0341"
FT   CDS_pept        397057..397347
FT                   /locus_tag="Acfer_0341"
FT                   /gene_family="HOG000111610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L27"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: ter:Tery_3242 50S ribosomal protein L27"
FT                   /db_xref="GI:284047723"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="GeneID:8736789"
FT                   /translation="MFELILQLHAHKKGSGSTHNGRDSNAQRMGTKAHDGQLVTAGSII
FT                   VRQRGTRFHMGQNVGMGKDYTIYAKVAGKVAFERWGKDRRTISVYPVEAEA"
FT                   /protein_id="YP_003398062.1"
FT   misc_feature    397084..397335
FT                   /note="Ribosomal L27 protein; Region: Ribosomal_L27;
FT                   cl00359"
FT                   /db_xref="CDD:174144"
FT                   /locus_tag="Acfer_0341"
FT   gene            397408..397794
FT                   /db_xref="GeneID:8736790"
FT                   /locus_tag="Acfer_0342"
FT   CDS_pept        397408..397794
FT                   /locus_tag="Acfer_0342"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:284047724"
FT                   /db_xref="GeneID:8736790"
FT                   /translation="MEEAMREQVRAFAARGLESLEQEDLPDARGNLVLTCEALRDRKGA
FT                   ETCCSREEMEALDRVLRELEAFPKLAANAGDSLLDLEGVRCYGAGRFLIFYRYNSNYGL
FT                   VTVIRLALDHPEWNGLIRDGKKFH"
FT                   /protein_id="YP_003398063.1"
FT   gene            398086..401820
FT                   /db_xref="GeneID:8736791"
FT                   /locus_tag="Acfer_0343"
FT   CDS_pept        398086..401820
FT                   /locus_tag="Acfer_0343"
FT                   /gene_family="HOG000218611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.6"
FT                   /transl_table="11"
FT                   /note="KEGG: sth:STH3085 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2 domain 2; RNA polymerase
FT                   Rpb2 domain 3; DNA-directed RNA polymerase, beta subunit,
FT                   external 1 domain; RNA polymerase Rpb2 domain 7"
FT                   /db_xref="GI:284047725"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="GeneID:8736791"
FT                   /translation="MFKPVHNGDRIRYSYARIKEVLKMPHLIDLQRKSYEWFIREGLHD
FT                   VFKDVSPIKDFTDNLELSFENFTIGDPKYDIETCKEKDATYAAPLNVDVRLLYKDTGEI
FT                   KESTVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPGVYYAKDMDPMGKFLYGTTVIPN
FT                   RGAWIEYETDLNDIIYARVDRTRKLPATALLRVMGLPTNDDIIQTFGEHPFLMATLAKD
FT                   TTKNEEDALLEIYRKLRPGEPANLENAAQLIKNIFSDNRRYDLANVGRYKVNKKLGWRQ
FT                   RLLGKELTSPIAFENPDGTRGEVVLPAGTIIGDEEIDKIEQSGIYSQPGYAEVWVKYQE
FT                   KPEQMIVTKDIDSSVRVITPADVIASFAYLLNVIDGMEGKDDIDHLGNRRVRCVGELLQ
FT                   NQFRIGLSRMERVIRERMTLQDADVITPQALINIRPVVAAVKEFFGSSQLSQFMDQNNP
FT                   LAELTHKRRLSALGPGGLSRERAGYEVRDVHVSHYGRMCPIETPEGPNIGLIGSLAAYG
FT                   VVNRYGFIETPYRKVDKKTGKVTNEIVYMTADEEDNYIVAQANEPLNDDGTFVNSHVTC
FT                   RERNDVLSIPPSRVDFMDVSPKQVMSIAAALIPFLENDDANRALMGANMQRQAVPLLNP
FT                   KAPVVGTGMEYKVAVDSGVCILAKHAGTVKYVSGDKIIVTRADGAGIDEYNVLKFKRSN
FT                   QSTCVNQRPIVFKGDKVEEGQVLADGPATDHGELALGRNAIAAYMPWEGYNYEDAVLLS
FT                   EDLVKEDVFTSIHIEEYNCDARDTKLGPEEITRDIPNVSEEALKDLDEDGIIRIGAEVR
FT                   PGDILVGKVTPKGETELSAEERLIRAIFAEKAREVRDSSLRVPHGESGIIVSVQIFTRE
FT                   NGDELPPGVSKQVRVHIVQKRKISEGDKMAGRHGNKGVVSRIMPREDMPFLPNGEPVQI
FT                   VLNPLGVPSRMNIGQILEAHLGWAACALGMRIESGDPKLAGELKEAGYDVDKYGMPETV
FT                   DHAVPVAVPVFDSAREDDMEKTLQLAGVDPSGKTTLYDGRTGEPFDNPVTVGCIYYLKL
FT                   HHLVADKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVK
FT                   SDDVVGRVKAYEAIVKGENIPEPGVPESFKVLVKEMQSIGLDIQVLDEDDDEIDLDDED
FT                   EDIGMGDIARELDMDMANKAPHTAANVGEEHPEQNSGEELSPDEDQPEGSDFDVIADIG
FT                   NMSLDDSHDDGDDNGSDAE"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /protein_id="YP_003398064.1"
FT   misc_feature    398113..401520
FT                   /note="DNA-directed RNA polymerase, beta subunit/140 kD
FT                   subunit [Transcription]; Region: RpoB; COG0085"
FT                   /db_xref="CDD:30434"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    398164..>398655
FT                   /note="RNA polymerase beta subunit. RNA polymerases
FT                   catalyse the DNA dependent polymerization of RNA.
FT                   Prokaryotes contain a single RNA polymerase compared to
FT                   three in eukaryotes (not including mitochondrial. and
FT                   chloroplast polymerases). Each RNA polymerase...; Region:
FT                   RNA_pol_B_RPB2; cl04593"
FT                   /db_xref="CDD:156170"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    398497..>398919
FT                   /note="RNA polymerase beta subunit; Region: RNA_pol_Rpb2_1;
FT                   cl04591"
FT                   /db_xref="CDD:123212"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    <399169..401520
FT                   /note="RNA polymerase beta subunit. RNA polymerases
FT                   catalyse the DNA dependent polymerization of RNA.
FT                   Prokaryotes contain a single RNA polymerase compared to
FT                   three in eukaryotes (not including mitochondrial. and
FT                   chloroplast polymerases). Each RNA polymerase...; Region:
FT                   RNA_pol_B_RPB2; cd00653"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    order(399535..399537,399541..399549,399553..399555,
FT                   399562..399564,399577..399579,399865..399867,
FT                   399919..399927,399931..399933,400297..400308,
FT                   400315..400317,400321..400329,400804..400806,
FT                   400810..400812,400816..400818,400882..400884,
FT                   400888..400890,400897..400899,400906..400908,
FT                   400921..400923,400933..400935,401083..401085,
FT                   401164..401166,401188..401196,401200..401202,
FT                   401239..401241,401248..401256,401260..401265,
FT                   401326..401334,401344..401346,401350..401355,
FT                   401359..401361,401365..401382,401386..401403,
FT                   401413..401415,401482..401484,401494..401496,
FT                   401500..401502,401506..401511,401515..401517)
FT                   /note="RPB1 interaction site; other site"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    order(400186..400191,400282..400284,400288..400290,
FT                   400351..400353,400360..400362,400831..400833,
FT                   400870..400872,400951..400956,400960..400962,
FT                   401152..401154,401203..401205)
FT                   /note="RPB10 interaction site; other site"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    order(400315..400317,400357..400359,400828..400830,
FT                   401170..401172)
FT                   /note="RPB11 interaction site; other site"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    order(400357..400362,400372..400374,400750..400752,
FT                   400756..400758,400831..400839,400846..400848,
FT                   400852..400857,401167..401190,401194..401196)
FT                   /note="RPB3 interaction site; other site"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   misc_feature    order(400372..400374,400483..400485,400489..400491,
FT                   400501..400509,400513..400515)
FT                   /note="RPB12 interaction site; other site"
FT                   /db_xref="CDD:73223"
FT                   /locus_tag="Acfer_0343"
FT   gene            401837..405892
FT                   /db_xref="GeneID:8736792"
FT                   /locus_tag="Acfer_0344"
FT   CDS_pept        401837..405892
FT                   /locus_tag="Acfer_0344"
FT                   /gene_family="HOG000218387" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: mta:Moth_2467 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   Rpb1 domain 4; RNA polymerase Rpb1 domain 5; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="GI:284047726"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="GeneID:8736792"
FT                   /translation="MLDVNKFHSMRIGLASPEKIRAWSHGEVTKPETINYRTLKPERDG
FT                   LFCERIFGPTKDWECHCGKYKRIRYKGVVCDKCGVEVTRSKVRRDRMGSIELAAPVSHI
FT                   WYFKGIPCRMGAILDIGQRALEKVLYFASYIVLDPGDTNLTKKQLLTEAEYQEKLDEYG
FT                   PTFRVGMGAEAIKELLHEINVEELTKELRAALKTETSLQKRRNIVRRLDVCEAFLKSGN
FT                   KPEWMIMDVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLQELQAPDII
FT                   VRNEKRMLQEAVDALIDNGRRGRAVTGPGTRPLKSLSDMLKGKQGRFRQNLLGKRVDYS
FT                   GRSVIVVGPEMKMHQCGLPKEMALELFKPFVMKRLVETGAATNIKSAKRMVERATNAVW
FT                   DVLEDVIKEHPVLLNRAPTLHRLGIQAFEPILSEGRAIKLHPLVCTPYNADFDGDQMAV
FT                   HLPLSAEAQAEARVLMMSVNNILAPKDGKPITVPTQDMVLGAYYLTIFKDGAKGEGRRF
FT                   ISFDEARLAYFNHVIDLQARIKVKVPNAEIFPEPSDQGESLVTTSMGNIIYNCELPVEM
FT                   RYYSKQEDGTWLLGKLIDKKELGRLVAKAHKLYGNFGTARVLDIVKKLGYDNACKSGLS
FT                   IAASDIKIPKEKASILAAAEKQVDKVETIFNRGLMSDDERYRKVIAIWDKATEDVANAL
FT                   MKHTMDPFNPVYMMANSGARGNVQQIRQLAGMRGLMADPSGRIIDRPIKSNFREGLTIL
FT                   EYFISSHGARKGLTDTALRTADSGYLTRRLVDVAQDVIVREDDCDVTGMNLVRERARFC
FT                   KAVLGSSQHKLKDYAIGRTLAASVMDPEGDSILAEADTVVTEEVYDRLMAAHILEISLY
FT                   PADEESGEEPETLAINVPEDKVKAAFREHMTHHFLDKQVEEDIVNEKDEVLAKAGDKFT
FT                   ADVIEKILEDGTVKELKIRNNEVDGVYVEAITSGKNKSTVLESLRDRLVGRTLAEDIAD
FT                   KDGKVIYHINDYITEDMADVIADLREKVKIRSVLTCKSHFGVCRACYGRNLATAKKVEV
FT                   GEAVGTIAAQAIGEPGTQLTMRTFHTGGVAGADDITQGLPRVEELFEARKPKHPGILTE
FT                   VAGTVDIQEKDEGRFVVIRKEDGTEESYHIPYGAKIHVAEGDKVEVGDRLTEGSLNPHD
FT                   ILRISGPAATRHYLVQQVLGVYKSQGVEINDKHVEVMVRQMMRKYKIDEAGDTNMLPGS
FT                   VVDIAQFEDENDEVLAEGKQPATGHPILLGITKASLATDSFLSAASFQETTRNLTDAAI
FT                   KGKVDPLLGLKENVIIGKLIPAGTGMPKYRNIQLKIHRPAEAAEEAPAVTSEAPAAEAP
FT                   AAEAPVEE"
FT                   /protein_id="YP_003398065.1"
FT   misc_feature    401846..404356
FT                   /note="DNA-directed RNA polymerase, beta' subunit/160 kD
FT                   subunit [Transcription]; Region: RpoC; COG0086"
FT                   /db_xref="CDD:30435"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    401849..402832
FT                   /note="RNA polymerase Rpb1, domain 1; Region:
FT                   RNA_pol_Rpb1_1; pfam04997"
FT                   /db_xref="CDD:147265"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    402509..403339
FT                   /note="RNA polymerase Rpb1, domain 2; Region:
FT                   RNA_pol_Rpb1_2; cl11591"
FT                   /db_xref="CDD:159564"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    403271..403759
FT                   /note="RNA polymerase Rpb1, domain 3; Region:
FT                   RNA_pol_Rpb1_3; pfam04983"
FT                   /db_xref="CDD:147253"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    403847..404077
FT                   /note="RNA polymerase Rpb1, domain 4; Region:
FT                   RNA_pol_Rpb1_4; pfam05000"
FT                   /db_xref="CDD:147268"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    404699..>405067
FT                   /note="RNA polymerase beta'' subunit; Reviewed; Region:
FT                   rpoC2; CHL00117"
FT                   /db_xref="CDD:164511"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    404966..405766
FT                   /note="Largest subunit (beta') of Bacterial DNA-dependent
FT                   RNA polymerase (RNAP), C-terminal domain; Region:
FT                   RNAP_beta'_C; cd02655"
FT                   /db_xref="CDD:132721"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    order(404966..404968,404975..404980,404984..404986,
FT                   405758..405760)
FT                   /note="Rpb1 (beta') - Rpb6 (omega) interaction site; other
FT                   site"
FT                   /db_xref="CDD:132721"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    order(404996..404998,405008..405010,405698..405700,
FT                   405716..405718,405734..405736,405743..405748,
FT                   405758..405760)
FT                   /note="Rpb1 (beta') - Rpb2 (beta) interaction site; other
FT                   site"
FT                   /db_xref="CDD:132721"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    405041..405067
FT                   /note="G-loop; other site"
FT                   /db_xref="CDD:132721"
FT                   /locus_tag="Acfer_0344"
FT   misc_feature    order(405125..405127,405608..405610,405653..405658)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:132721"
FT                   /locus_tag="Acfer_0344"
FT   gene            complement(405960..406589)
FT                   /db_xref="GeneID:8736793"
FT                   /locus_tag="Acfer_0345"
FT   CDS_pept        complement(405960..406589)
FT                   /locus_tag="Acfer_0345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /codon_start="1"
FT                   /product="NERD domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NERD domain protein"
FT                   /db_xref="GI:284047727"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="GeneID:8736793"
FT                   /translation="MEEVVIQIFPNMTVWKLHSLKEYLVFFLMLLGGFLVFRFWIRRMK
FT                   KNRTWEGGRKRTLDAVKSGSRKDFTDVSSYTFDFSPDSLCILLPHDILLLRVVYHGYRI
FT                   QGSERSEQWELKDNSGIISVPNPLQLLEKEREKLEKSLEAAHSPQLPIHTFVIGADNYA
FT                   EPVFQLDEGARSHALSLPELKKWIRQRNLDPITEKKRQEILAVFGR"
FT                   /protein_id="YP_003398066.1"
FT   gene            406827..408371
FT                   /db_xref="GeneID:8736794"
FT                   /locus_tag="Acfer_0346"
FT   CDS_pept        406827..408371
FT                   /locus_tag="Acfer_0346"
FT                   /gene_family="HOG000285565" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /codon_start="1"
FT                   /product="AbgT putative transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: AbgT putative transporter; KEGG: oih:OB3284
FT                   aminobenzoyl-glutamate transporter"
FT                   /db_xref="GI:284047728"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="GeneID:8736794"
FT                   /translation="MVAKNAAKQTWVDRFLNTIETVCNKLPPPAILFVVLFLITAVIGA
FT                   GLTSTGFSLTNPATGKAVVSQNLFSKAGVQWLLTNLVKNFTGFAPLGLVITMTMAIGFC
FT                   EESGLLVAMLRRSLKNVPPGVVPYLIAFLGTCGNIASDTAMIVIPPLAAIVYIGVKKHP
FT                   VVGMMVGYAGAQAGFTANLMVAGTDSLLQGLTNQAIDAFLGAPGLFAVDVTCNWYFLFV
FT                   STFLCGAVIGWVSIHIIEPRFPKYEGSEEESLMEEVTPLEIKGLHNAGLACLVYIAIVI
FT                   VGFKTQVLSKDGVTVVGSLMLKGLIPLLFFLFSIAGIVYGKTTGKFTNVKSINSAMVKQ
FT                   MSGMGAYVVFCFFCGQFQGLFNWTKLGTLLAISGANFLKGVGFTGIPMCIAFILISAIV
FT                   NIFVSSGSAKWAIFAPIFVPMFMLLGYHPGFTQLLYRLGDSPGNCFTPMSPYIWMILSV
FT                   AQEKYMPDCAIGTLISNMIPIAVVLQIAWIIFLVIWMMLGLPFGPGVGIALPAGVL"
FT                   /protein_id="YP_003398067.1"
FT   misc_feature    406827..408359
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Acfer_0346"
FT   misc_feature    406866..408359
FT                   /note="p-Aminobenzoyl-glutamate transporter family; Region:
FT                   ydaH; TIGR00819"
FT                   /db_xref="CDD:129899"
FT                   /locus_tag="Acfer_0346"
FT   gene            408939..410483
FT                   /db_xref="GeneID:8736795"
FT                   /locus_tag="Acfer_0347"
FT   CDS_pept        408939..410483
FT                   /locus_tag="Acfer_0347"
FT                   /gene_family="HOG000285565" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /codon_start="1"
FT                   /product="AbgT putative transporter"
FT                   /transl_table="11"
FT                   /note="PFAM