(data stored in ACNUC7421 zone)

HOGENOMDNA: ACISJ_3.PE1

ACISJ_3.PE1          Location/Qualifiers
FT   CDS_pept        212..694
FT                   /locus_tag="Ajs_0001"
FT                   /gene_family="HOG000229978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NLP/P60 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rfr:Rfer_0741 NLP/P60"
FT                   /db_xref="GI:121592437"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="GeneID:4672148"
FT                   /translation="MRAFALPVLTLAASLLVVGCGTTPPTSASRNAAYSRLSPEQSSDI
FT                   AIHALGLVGTPYRYGGNTPDSGFDCSGLIGYVYTSRAGVAPPRTVAQLSGFGQSVDADE
FT                   LRTGDLVVFGRGRPTHAGIYVGEGRFVHAPSSGGTVRLDHLKSRYWSQQFASFRRP"
FT                   /protein_id="YP_984333.1"
     ATGCGCGCCT TTGCCCTTCC CGTCCTGACG CTCGCGGCCA GCCTGCTGGT GGTGGGCTGC        60
     GGCACCACGC CGCCCACCTC TGCCTCGCGC AACGCCGCCT ATTCCCGCCT GTCGCCCGAG       120
     CAGTCGAGCG ACATCGCCAT CCATGCCCTG GGACTGGTGG GCACGCCCTA CCGCTACGGC       180
     GGCAATACGC CCGACAGCGG CTTCGACTGC AGCGGCCTCA TCGGCTACGT GTACACCAGC       240
     CGCGCGGGCG TGGCCCCGCC GCGCACGGTG GCCCAGTTGA GCGGCTTCGG CCAGTCCGTC       300
     GACGCGGACG AGCTGCGCAC GGGCGACCTG GTGGTGTTCG GCCGCGGCCG GCCCACGCAT       360
     GCCGGCATTT ACGTGGGAGA GGGGCGCTTC GTACATGCGC CGTCCAGCGG CGGCACGGTG       420
     CGCCTGGACC ACCTGAAGTC GCGCTACTGG TCGCAACAGT TCGCGAGCTT CCGGCGCCCC       480
     TGA                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page